KEGG   Pseudoalteromonas sp. SM9913: PSM_B0316
Entry
PSM_B0316         CDS       T01374                                 

Definition
(GenBank) putative NADH-dependent flavin oxidoreductase
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Motif
Pfam: Oxidored_FMN Dus TMP-TENI G3P_antiterm
Other DBs
NCBI-ProteinID: ADT70356
Position
II:360357..361451
AA seq 364 aa
MSKLFSPLSLGKLSLENRIIIAPMCQYSANNGAASDWHTIHLGQLSLSGAGLLILEATAV
NPEGRISYADLGLWDDTTQAALAKSLTAVRQYSPMPIGIQLAHAGRKASTDKPWDGGGAL
IPDHLNGWQTVAPSAIAYDENSPTPKAMNQDDIDSLISDFVNAAKRADELGLDLIEIHGA
HGYLLHQFLSPLANKRDDQYGGSLENRMRLLLDVFKAVRTAFPSNKAVGVRISATDWVDG
GWDLPQSIELAKALDALGCDFIHVSTAGLSPEQDIPVVKNFQVPFATAIKQVVNMPVIAV
GLITEAQQAESIISDERADGVALARGILYNPHWPWHAAAELGAQVQAPKQYLRSSPHGKP
SPIK
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgtcaaagctgttttcaccattgtcacttggtaagttaagcctagagaatagaattatt
attgcacccatgtgccagtactcggccaacaatggcgctgcaagtgactggcataccatt
catttagggcaattgagtttaagtggagcgggtttacttattttagaagcgacggccgtt
aatcccgaagggcgaattagttacgccgatttaggattatgggatgatacaacccaagct
gcattagcaaaaagtttaacggccgtaagacaatacagcccaatgcctattggtattcaa
ttagcccatgcaggtcgtaaagcgtcaaccgataaaccatgggatggcggtggggcactt
atacccgatcacctcaatggttggcaaacggttgcgccatcagccattgcctatgatgaa
aacagccccactcccaaagcgatgaaccaagatgatatagattcgctcataagtgacttt
gttaatgcggcaaagcgcgctgacgagttgggccttgatttaatagaaatacatggcgca
cacggttatttgctacaccagttcttatcgccgctggcaaacaaacgtgatgatcaatac
ggtggtagcctagaaaatagaatgcgattattactcgacgtatttaaagctgtaagaacg
gcatttccaagcaataaagcggtgggtgtacgtatttcagcaaccgattgggttgatggt
ggttgggatttaccgcaatcaattgaactggcaaaagcgcttgacgcgttagggtgtgac
tttattcatgtaagcactgcgggtttaagccctgagcaagatatacctgttgttaagaat
tttcaggtgccgtttgcaaccgccattaaacaggttgtgaatatgccagtgatagcggtg
ggtttaattaccgaggcgcagcaagctgaaagtattattagtgatgaacgtgctgatggt
gtcgctttagcgcgggggattttatataacccacattggccttggcatgctgcggccgag
ttgggcgcgcaagtgcaggcaccaaagcaatatttgcgctcaagcccacatggcaagcca
tcccctataaaatag

DBGET integrated database retrieval system