KEGG   Pseudoalteromonas sp. SM9913: PSM_B0317
Entry
PSM_B0317         CDS       T01374                                 

Gene name
rhtA
Definition
(GenBank) transporter involved in threonine and homoserine efflux
  KO
K11939  inner membrane transporter RhtA
Organism
psm  Pseudoalteromonas sp. SM9913
Brite
KEGG Orthology (KO) [BR:psm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psm02000]
    PSM_B0317 (rhtA)
Transporters [BR:psm02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   PSM_B0317 (rhtA)
SSDB
Motif
Pfam: EamA
Other DBs
NCBI-ProteinID: ADT70357
Position
II:complement(361528..362397)
AA seq 289 aa
MQKSTKELLLAILCILLAMITIQSGASLAKQLFPIVGPEGTTALRLGFSAAILCLIFKPW
RHFPVASQRLPILIYGLSLGGMNILFYYAIERIPLGIGVALEFTGPLAVALFSSRRKRDL
FWVACAITGILLLLPDMKGQESLDPIGVILALAAGACWAGYILFGKKTGSQSSGGATVAM
GMTISAIVLVPYGGISQSAAFTWDIIPLGIAIAVLSSALPYTLEMITLRNMSPQGFSIMM
SLEPAIAALAGLVILGELLSIWQWLAILLVIIASVGSSTSNSKKQPSPA
NT seq 870 nt   +upstreamnt  +downstreamnt
atgcaaaaatcaaccaaagagctattactggctattttatgcatattgcttgcaatgatc
actattcagtctggggcttcactggctaagcagcttttccctattgttggccctgagggc
acaacggccttacgtttaggtttttctgccgctattctttgtttaatttttaaaccttgg
agacactttccggttgcaagccagcgtttacccatcttaatttatggtttgagcctaggc
ggcatgaacattctattttattacgccattgaacgtattccactgggtattggtgttgcg
cttgaatttaccgggccacttgccgttgcgttattttcatcaagacgaaagcgtgattta
ttttgggttgcttgcgcaattaccggaatattattactgttacccgatatgaaaggccaa
gaaagtttagatccaattggcgtgattttagctctagcagcgggtgcgtgttgggcaggt
tatattttatttggtaaaaaaaccggcagccaaagctctggtggcgcaacagtagcgatg
ggcatgaccatttcagctattgtgcttgtaccttatggtggcatatcacaaagtgccgca
tttacttgggatattattccgttaggtattgccattgcggtactctctagtgccctacct
tatactttagaaatgatcacgctgcgtaatatgtcgccgcaagggtttagcattatgatg
agccttgaacccgctattgcagcactcgctggcttagttattttaggtgaactacttagc
atttggcagtggcttgctattttattagttattattgcctcggttggcagctcaacgtca
aacagtaaaaagcagccatctcctgcttaa

DBGET integrated database retrieval system