KEGG   Pseudoalteromonas sp. SM9913: PSM_B0318
Entry
PSM_B0318         CDS       T01374                                 

Definition
(GenBank) oxidoreductase
  KO
K22230  scyllo-inositol 2-dehydrogenase (NADP+) [EC:1.1.1.-]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
psm00562  Inositol phosphate metabolism
psm01100  Metabolic pathways
psm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    PSM_B0318
Enzymes [BR:psm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     PSM_B0318
SSDB
Motif
Pfam: GFO_IDH_MocA NAD_binding_3 GFO_IDH_MocA_C
Other DBs
NCBI-ProteinID: ADT70358
Position
II:complement(362591..363592)
AA seq 333 aa
MNFVIVGTNFISDTLLDAASTLSNFNLYGVCSRAESSAERFLANHPTHSQAKIFTSIDAV
CQDELVEAVYIAAPNSLHKDYAVQCLAAGKHVLGEKPSAANSHELTAILTAAQKHQRLYM
EAMMTTHLPNFAVLKNALKRIGTPRKFIGQFSQYSSRYDKLKNGERPNTFLPEFANGALV
DLGIYPLYLLIALWGAPNSVHASGVLLETGVDGAGDVLLNYADKQAVISYSKISQGENIT
EIQGELGRIRIEAVSQLKKVEFIANNGQKETISTDFDEHFMKYEVAHFIEMIEQNALESH
INNHQLSRDVMTVLDTARAQLGVIYPADSKAKL
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgaattttgtgattgtaggtaccaattttattagcgacaccctactcgatgcggcaagt
actctgagtaattttaatttatacggtgtgtgttctcgggcagaaagtagcgctgagcga
tttttagctaatcaccccactcattctcaagcaaaaatattcacctccattgacgctgtt
tgccaagacgagcttgtagaggcagtatacattgccgcacctaatagcctgcataaagac
tatgctgtgcaatgtttagctgcgggcaaacacgtacttggcgaaaaaccctcagcagca
aatagtcatgagcttactgctattttaacggctgctcaaaaacatcaacgtttgtacatg
gaagcgatgatgacaacgcatttacctaactttgctgttttaaaaaacgcattaaaaaga
atcggtacaccgcgtaaatttattggccaatttagccaatactcgtctcgttacgataag
ctcaaaaacggcgagcgccctaatacctttttacctgaatttgcaaatggcgcattagta
gacttgggtatttacccactttatttacttatagcactgtggggcgcaccaaacagtgtg
cacgccagtggcgtattactagaaaccggtgttgatggtgccggcgatgtacttttaaat
tatgcagataaacaagcggtaattagttattcaaaaatatcgcaaggcgagaacatcacc
gaaatacaaggtgagttaggccgtattcgtattgaagctgtatcgcaacttaaaaaagtg
gaattcatcgctaataatggccaaaaagaaacaataagtacagattttgatgagcatttt
atgaagtatgaagtggcacactttattgaaatgattgagcaaaatgcattagagtcacat
attaacaaccaccagctttcacgcgatgtgatgacggttctcgataccgcccgcgcacaa
ttaggcgttatataccctgcagatagtaaagctaaactataa

DBGET integrated database retrieval system