KEGG   Pseudoalteromonas sp. SM9913: PSM_B0319
Entry
PSM_B0319         CDS       T01374                                 

Definition
(GenBank) AraC family transcriptional regulator
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Motif
Pfam: Arabinose_bd HTH_18 HTH_AraC HTH_38 HTH_23
Other DBs
NCBI-ProteinID: ADT70359
Position
II:complement(363630..364631)
AA seq 333 aa
MSSLIKATSLQGIDTLITELGGDTANIMRHCAIEVTLNSLETQSLTYRHYAELLEYCAHS
LNCPSFGLKLASKQSFDILGHIAIAAKSGTDLGEALTWVIKYLHLHTPALNLTTHTLEDD
QNIFLSFEIKLKPLPVINQVIELTIALALATLKKVSQNQCKPIKVFLPQKLDANLRAYHQ
HFGCNVIEHRNSAGILIAKNDLLLPLNVSDQHKVQAALNFLAANNAHTQSLPSQVSALIR
PMLPLFQCSNQTIATALNLHPRTLHRELKKHNTSFVKLKDATRRALCEHYLMQNQFSISH
ISELLGYQEQATLSASVKRWFNCSARAFRAKYC
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgagcagcctaattaaagccacttctttacagggaattgatacattaattaccgaacta
ggtggtgatacagcaaacattatgcgacattgcgctattgaggtaacgttaaactccctt
gaaacccaaagcttaacttatcgccattatgccgaacttttagaatactgcgctcatagc
ttaaactgcccaagttttggtcttaaactcgctagcaaacaaagttttgatattttaggg
catatcgctatcgccgctaaaagtggaactgatttaggtgaagcgcttacatgggtaatt
aaatacctgcacttacatacacccgcacttaatttaaccacgcatacacttgaagatgac
caaaatatatttttatcattcgaaataaaactcaagccattacctgttataaatcaagtt
attgaattaacaattgcactggcgctcgctaccttaaaaaaagtgagccaaaatcaatgt
aaacccattaaggtatttttaccgcaaaagcttgatgcaaatctgcgcgcttaccatcaa
cactttggctgtaacgttattgaacacagaaacagcgccggtattttaatcgccaaaaac
gatttattattgccacttaatgtttctgatcaacacaaagtacaagccgcattaaacttt
ttagccgctaataatgcgcatactcagtcgttaccttcgcaagtaagtgcacttattcga
cccatgctgcccctttttcaatgctcaaatcaaacgatagcaacggcacttaatctgcat
cctcgcaccttgcatcgtgaacttaaaaaacataacaccagctttgtaaaactaaaagat
gccactcgccgcgcattatgtgaacactatttaatgcaaaaccaattttctatttcacat
atttccgagctgttaggttatcaagaacaagccacattaagtgccagtgtaaaacgctgg
tttaactgctctgctcgcgcatttagagcaaaatattgttaa

DBGET integrated database retrieval system