KEGG   Pseudoalteromonas sp. SM9913: PSM_B0320
Entry
PSM_B0320         CDS       T01374                                 

Definition
(GenBank) putative choline dehydrogenase
  KO
K00108  choline dehydrogenase [EC:1.1.99.1]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
psm00260  Glycine, serine and threonine metabolism
psm01100  Metabolic pathways
Module
psm_M00555  Betaine biosynthesis, choline => betaine
Brite
KEGG Orthology (KO) [BR:psm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSM_B0320
Enzymes [BR:psm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.99  With unknown physiological acceptors
    1.1.99.1  choline dehydrogenase
     PSM_B0320
SSDB
Motif
Pfam: GMC_oxred_N GMC_oxred_C Lycopene_cycl FAD_binding_2 Pyr_redox_2 Pyr_redox_3 DAO NAD_binding_8 Thi4 HI0933_like GIDA ApbA
Other DBs
NCBI-ProteinID: ADT70360
Position
II:364721..366319
AA seq 532 aa
MHTTSFDYIVIGAGSAGCVVASRLSENKNVSVCLIEAGSRDQSAMVQMPAGVAASVPYGI
NSWHYNTVPQKELNNRCGFMPRGKVLGGSSSINAMVYIRGNKKDYDNWAAMGNTGWDYTS
LLPYFIKAENNKTFINSPYHGVNGPLHVQELSLPSPVNQLFLKACQEQGVALNDDINAQQ
QLGARLSQVTQHKGERCSAAKAYLTPNLARKNLTVLTDAQVHKINFCGKSATGVTVAVNN
KSYVLNAHKEVILSAGAINSPQLLMLSGVGPADHLKQHNIELVTPLEGVGSNLHDHLTVV
PLYKAKYSQGTFGISASGAFNIAKGCVDWFAKREGKLTSNFAESHAFINLFTDSIVPDVQ
LEFVIGLVDDHSRKLHYGHGYSIHSSIMHPKSRGTIRLADANPVSAPLIDPNYLSHPDDL
QVMLLGLKKTLSIMQSKAFDTIRADMVYPLDINDDAQLIEFIRQTADTEYHPVGTCKMGQ
DDMAVVDSELRVHGVQNLRVVDASIMPSIITGNTNAGVIAIAEKAADLIRVC
NT seq 1599 nt   +upstreamnt  +downstreamnt
atgcataccacctcatttgattacattgtgattggcgcaggcagtgccggctgtgttgtt
gcctcgcgattatctgaaaataaaaatgtgagtgtgtgtttaattgaagccggcagccgt
gaccaaagtgctatggtgcaaatgcctgcgggagttgcagctagtgtgccttatggcatt
aatagctggcattacaatacggtgccacaaaaagagcttaataaccgctgtgggtttatg
cccagaggtaaagtgcttggtggttcaagttcaatcaatgccatggtgtacattagaggg
aataaaaaagactacgacaactgggccgctatgggaaataccggctgggattataccagt
ttgctgccttattttatcaaagctgaaaacaacaaaacctttatcaacagcccatatcat
ggtgtaaatggccccttacatgtgcaagagctaagtttaccaagcccagttaatcagctg
tttttaaaagcatgccaagagcaaggcgtagcccttaatgacgatattaatgcgcagcaa
cagctaggtgcgcggttatcgcaggtcactcaacataaaggggagcgttgcagtgcggca
aaagcgtacttaacacctaatttagctcgtaaaaacttaaccgtgctcactgatgcgcag
gtgcataaaattaatttttgcgggaaatctgcaactggtgtaacagttgcagttaataat
aaaagctatgtgctaaatgcccataaagaagttattttaagtgccggtgcgattaactcc
ccccaacttttaatgttatcgggagtggggcctgcagatcatttaaagcagcataacatt
gagcttgtaaccccattagaaggtgtaggcagtaatttgcacgatcacttaaccgttgtg
ccattatacaaagcaaaatattcgcaaggcacatttggaataagtgccagcggtgcgttt
aatattgcaaaaggatgcgttgattggtttgccaaacgcgaaggaaagctaaccagtaac
tttgccgaatcacatgcgtttataaacttatttacagattctattgtgcccgatgtgcaa
cttgaatttgttattgggctggtggacgatcacagccgtaaactgcattatggccatgga
tacagtattcatagcagcataatgcaccctaaaagccgcggcactattcgtttagcggat
gccaaccctgtaagtgcgccactcattgatcctaattatttaagccaccccgatgattta
caggttatgctacttgggctaaaaaaaacattgagcataatgcaaagcaaagcgtttgat
actattcgtgcagatatggtgtatccgcttgatattaatgatgatgcgcagcttattgag
tttattaggcaaacagccgatacagaatatcaccccgtaggaacctgcaaaatgggccaa
gacgatatggctgtggttgatagcgaattacgtgttcacggtgtgcaaaatttacgggtg
gtagacgcctctataatgcccagtattattaccggaaataccaatgctggggtaatagca
attgcagaaaaagcagctgacttaattagggtctgttga

DBGET integrated database retrieval system