KEGG   Pseudoalteromonas sp. SM9913: PSM_B0321
Entry
PSM_B0321         CDS       T01374                                 

Definition
(GenBank) hypothetical protein
  KO
K19307  25S rRNA (uracil2634-N3)-methyltransferase [EC:2.1.1.313]
Organism
psm  Pseudoalteromonas sp. SM9913
Brite
KEGG Orthology (KO) [BR:psm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:psm03009]
    PSM_B0321
Enzymes [BR:psm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.313  25S rRNA (uracil2634-N3)-methyltransferase
     PSM_B0321
Ribosome biogenesis [BR:psm03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   PSM_B0321
SSDB
Motif
Pfam: DUF2431 zf-C2H2_2
Other DBs
NCBI-ProteinID: ADT70361
Position
II:complement(366587..367396)
AA seq 269 aa
MYLNPNWNILTVGDGDLSFSNALYNHIKPQKLVASTYDAAATLTEKYPDNALASLKAHKI
DVLNEFDVTNTQCWQQLAEHLNSFDVVIFQFPLIPAFIGRDAFDKNTRNNSMNVLNRALL
HQFIKYANEFALNPQGPGLCYITSKDVKPYREWNIEGSLNTHLNAAYQGQMPFDISRFDG
YKIRNVDRDKHVKDTSGITYVFSENTLPELSDMLTTPNYLTDDYCPLCRVGPFLADEDKN
KHFAAKKHQQMVKLEQDWQQWLTAFYKSS
NT seq 810 nt   +upstreamnt  +downstreamnt
atgtacttaaacccaaattggaacatactcacggtaggtgatggcgacttatcgttttca
aacgcgctttacaaccacattaaaccgcaaaagttagttgcctcaacctatgatgcagct
gcaactcttacagaaaaataccccgataacgcgcttgcctcacttaaagcacataaaatt
gatgtgcttaatgaatttgatgtcaccaacacacaatgttggcaacaactagccgagcac
ctaaacagctttgatgtagtgatttttcaatttccacttattcctgcgtttattggtcgc
gacgcatttgataaaaatacacgtaataacagcatgaacgtgcttaaccgtgcgttactg
catcaatttataaaatatgccaatgagtttgccttgaacccacaaggccctgggttatgc
tacataacctcaaaagatgttaaaccgtatcgtgagtggaatattgaggggagtttaaat
acccatttaaacgcggcataccaaggacaaatgccattcgatatcagtcgctttgatggc
tataaaattcgcaatgtcgaccgtgacaaacacgtcaaagacaccagcggtattacttat
gtatttagtgaaaatacactacccgaactaagtgatatgttaacaacccctaattatcta
actgatgattattgcccgctttgtcgtgtggggccgtttttagcggatgaagataaaaac
aaacattttgccgctaaaaaacaccagcaaatggtcaaactagagcaagactggcagcaa
tggttaacggcgttttataagtcaagttaa

DBGET integrated database retrieval system