KEGG   Pseudoalteromonas sp. SM9913: PSM_B0322
Entry
PSM_B0322         CDS       T01374                                 

Definition
(GenBank) hypothetical protein
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Motif
Pfam: Na_H_Exchanger
Other DBs
NCBI-ProteinID: ADT70362
Position
II:complement(367403..367801)
AA seq 132 aa
MIDQLRQQLTDLGENFVEKNAAFKIKVIPFFCAISIKKDHKSEGRLSFYSNQLIEIFMVV
LFVLFGLAIYDPQAGFTHGPIHIVFAILITFNLILKQVAIEGLKTRLAMYRLHQQLISTP
HPDTSPVTNKNI
NT seq 399 nt   +upstreamnt  +downstreamnt
atgatagaccaattacgccaacagcttactgaccttggtgagaattttgtagaaaaaaac
gctgctttcaaaattaaagtgatcccgtttttttgcgctattagcataaaaaaagatcat
aaaagtgaggggcgtctttctttttattcaaatcagctcattgaaatatttatggtggtg
ttgtttgttttatttggcttagccatttacgaccctcaagccggttttactcatggccct
attcatattgtgtttgctattttgattacctttaacttaattcttaaacaagttgccatc
gaagggttaaaaacgcgtttagctatgtataggttacatcaacagctgattagtacaccg
catcctgacacatcgcctgttactaataaaaacatataa

DBGET integrated database retrieval system