KEGG   Pseudoalteromonas sp. SM9913: PSM_B0323
Entry
PSM_B0323         CDS       T01374                                 

Definition
(GenBank) hypothetical protein
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Motif
Pfam: DUF3429 DUF3796
Other DBs
NCBI-ProteinID: ADT70363
Position
II:complement(367869..368288)
AA seq 139 aa
MEKFVNHIQLGYLGLLPFLGCVGWPLMFGSNSVNLEFFSFYSIAILAFMAGNLWHAGQQS
FADAIKAVLPVIPIPFLSFLPIEWMLAWLGASFWLVLIFEKATIQWQGYHKDYQKMRFVL
TSVVFVCHILIIGMSIYPK
NT seq 420 nt   +upstreamnt  +downstreamnt
atggaaaaattcgtcaatcacattcaactaggctatttaggcttattgccatttttaggc
tgtgtgggctggccgctcatgtttggcagtaacagtgtaaatttagagttttttagtttt
tacagcattgctattttagcgtttatggcgggtaatttatggcatgcaggccaacaaagc
tttgccgatgcgattaaagcagtgctaccggtcattcctattccgtttttatcattctta
ccgattgagtggatgcttgcttggttaggcgcgagtttttggttagtactgatttttgaa
aaggccacaatacagtggcagggttatcataaagattatcaaaaaatgcgctttgtgctc
acatctgtggtgtttgtttgtcatattcttattattggtatgagtatttaccctaaatag

DBGET integrated database retrieval system