KEGG   Pseudoalteromonas sp. SM9913: PSM_B0324
Entry
PSM_B0324         CDS       T01374                                 

Gene name
ahpC
Definition
(GenBank) alkyl hydroperoxide reductase subunit C
  KO
K24119  NADH-dependent peroxiredoxin subunit C [EC:1.11.1.26]
Organism
psm  Pseudoalteromonas sp. SM9913
Brite
KEGG Orthology (KO) [BR:psm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PSM_B0324 (ahpC)
Enzymes [BR:psm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.26  NADH-dependent peroxiredoxin
     PSM_B0324 (ahpC)
SSDB
Motif
Pfam: AhpC-TSA Redoxin 1-cysPrx_C SCO1-SenC
Other DBs
NCBI-ProteinID: ADT70364
Position
II:368586..369155
AA seq 189 aa
MSTSLINTKLQPFNATAYHNGDFVELTEKDVLGKWSIFFFYPADFTFVCPTELGDLADHY
AQLQEMGVEVYSVSTDTHFTHKAWHDTSDTIGKITYPMIGDPTGRITRNFGVMIEDDGLA
LRGTFVMNPEGEIKVVETHDLGIGRSAKELVRKVQAAQYIATHDGEVCPASWQPGEDTLA
PSLDLVGKI
NT seq 570 nt   +upstreamnt  +downstreamnt
atgagcacttcattgattaacacaaaattacaacctttcaatgcaacagcttaccacaat
ggtgactttgtagaactcactgaaaaagacgtattaggtaagtggtctatctttttcttt
taccctgcagatttcacatttgtatgcccaactgaattaggtgaccttgcagatcattac
gcacagttacaagaaatgggcgttgaagtttattcagtatcaactgatacacactttacg
cacaaagcatggcatgacacgtcagacaccatcggtaaaattacttacccaatgattggt
gacccaacaggacgcatcacacgtaactttggtgtcatgattgaagatgacggtttagca
cttcgcggtacatttgtaatgaaccctgaaggcgaaattaaagttgttgaaacacatgat
ttaggcattggtcgcagtgctaaagagttagttcgtaaagtacaagcagcgcaatacatt
gcaacacacgatggcgaagtttgtcctgcatcttggcagccaggtgaagacacattagca
ccttcactagacctagttggtaagatttaa

DBGET integrated database retrieval system