KEGG   Pseudoalteromonas sp. SM9913: PSM_B0325
Entry
PSM_B0325         CDS       T01374                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F (Alkyl hydroperoxide reductase F52A protein)
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
psm  Pseudoalteromonas sp. SM9913
Brite
KEGG Orthology (KO) [BR:psm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PSM_B0325 (ahpF)
Enzymes [BR:psm01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PSM_B0325 (ahpF)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like DAO FAD_oxidored Thi4 NAD_binding_9 NAD_binding_7 FAD_binding_3 NAD_binding_8 K_oxygenase Glutaredoxin FMO-like Lycopene_cycl SmaI Thioredoxin_9
Other DBs
NCBI-ProteinID: ADT70365
Position
II:369320..370897
AA seq 525 aa
MLDNNIKNQLKSHFESLTQPVELLIALDDSKKSTEVESLANDLASLSDKFSVINNPDTSA
RRPSMVVHSPEKNTHITFAGVPMGHEFTSLVLALLHTGGHPSKASKDDIEQIQTLEQTLN
FEVYISLSCQTCPQVVQALNTMAATNSNIKATMIDGALFQDEVEQRNILAVPAVYLNGEP
FSQGAMSLTDILNKVDSKGAQRQAASLNEKSVFDVLVVGGGPAGASAAIYSARKGLNTGV
VAERFGGQVADTLAIENFISIKAMQGPKMVAQLEEHVKEYDVDVMHNQRAANLQKGSNGY
DITLENGAVLKAKSLVLATGARWREMNVPGEQQYKGHGVAYCPHCDGPLFKGKPVAVIGG
GNSGIEAAIDLANIVEHVTVLEFADTLRADEVLIRKANSLKNITIIKNAQTTEVLGDGKK
VTGLSYTDRLSGESKQLNLAGIFVQIGLIPNTEWLKDSDLELSQFGEILIDAKGATSLQG
VYAAGDATTTPFKQIIIAMGAGATASLGAFDYLIRQTPDAEQSAA
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgttagataacaacataaagaaccaactaaaaagccattttgaatcgctgactcagcct
gttgagctgcttatcgccttggacgacagcaaaaaatcaacagaagtagaaagtcttgca
aacgatttagcgtcactaagcgataagtttagtgtaataaataatcccgatactagcgcc
cgcaggccttctatggtggtgcattcaccagaaaaaaacacccatattacctttgcaggt
gtacctatggggcacgaatttactagtttagtgttagcgctattacatacgggtggtcac
cctagtaaagcaagtaaagatgacattgaacaaatacaaacacttgaacaaacacttaat
tttgaagtgtatattagcttgagttgccaaacctgcccgcaagttgtgcaggcacttaat
actatggcagcaacaaatagtaatattaaagccaccatgattgatggggcgttatttcaa
gatgaagtagagcaaagaaacatactggctgtacccgctgtatatttgaatggtgaaccc
tttagccaaggggccatgagcctcactgatattttaaataaagtggatagcaaaggtgca
cagcgccaagcagcatcactcaatgaaaagtcggtgtttgatgtacttgtcgtcggtggt
gggccagctggtgcttcggcagctatttattcagcacgtaaagggctcaatactggggtt
gtagcagagcgatttggcggtcaagttgctgatacattagcgattgaaaattttatttca
attaaagcaatgcaagggccaaaaatggtggctcagttggaagaacacgttaaagaatac
gatgttgatgttatgcacaaccaacgcgcggcaaacctgcaaaaaggcagtaatgggtat
gatattactttagaaaatggcgctgtattaaaagcaaaatcactcgtactagcaaccggt
gcacgctggcgcgaaatgaatgtacccggtgagcaacagtataaaggccatggcgttgca
tactgcccgcactgtgatgggcctctatttaaaggtaaaccggttgcggttattggtggt
ggtaattcaggtattgaggcggcaattgatttagccaatatagttgaacacgttactgtg
cttgaatttgctgatacgttacgcgccgatgaggtacttattcgtaaagctaatagctta
aaaaacatcactattattaaaaacgcccaaaccacggaagtacttggtgatggcaaaaaa
gtaacggggttaagttataccgaccgcctaagcggcgagagtaaacagttgaacttagcc
ggtatatttgtacaaattggtttaatacctaataccgaatggttgaaagacagcgacctt
gaactgagccaatttggtgaaatactcattgatgccaaaggcgcaacatcgttacaaggc
gtttatgctgcaggtgatgcaaccactacgccatttaagcaaattattattgcgatgggg
gcgggcgcaacagcaagcctaggtgcgtttgactatttaattcgtcaaacgcccgatgca
gagcaaagcgctgcttaa

DBGET integrated database retrieval system