KEGG   Pseudoalteromonas sp. SM9913: PSM_B0326
Entry
PSM_B0326         CDS       T01374                                 

Definition
(GenBank) conserved hypothetical protein
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Motif
Pfam: DUF3185 DUF2371 DctQ DUF202 Trp_oprn_chp DUF373 DUF4148 YtpI DUF2627
Other DBs
NCBI-ProteinID: ADT70366
Position
II:complement(370993..371184)
AA seq 63 aa
MTNKIIGIVLIVIGIALAIWGYDVYDSAASQVTRALNGETPMEAWLGFIGGAVCILVGIT
RLK
NT seq 192 nt   +upstreamnt  +downstreamnt
atgacaaataaaattattggtattgtacttattgttattggtatcgcactggcaatatgg
ggctatgacgtttatgactcagcagcctctcaggttacccgcgcattaaacggcgaaaca
cctatggaagcctggcttggctttattggtggcgcagtctgtattttagtgggtattacc
cgacttaaatag

DBGET integrated database retrieval system