KEGG   Pseudoalteromonas sp. SM9913: PSM_B0327
Entry
PSM_B0327         CDS       T01374                                 

Definition
(GenBank) sensory transduction histidine kinase
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Motif
Pfam: HATPase_c Response_reg HisKA GAF_3 GAF PAS_3 HATPase_c_5 HATPase_c_3 PAS_9 HATPase_c_2 Dodecin GAF_2
Other DBs
NCBI-ProteinID: ADT70367
Position
II:complement(371233..373257)
AA seq 674 aa
MNFLRCFHNIVSDQQLSFDQKIADLLAFGLDVFQLDLAIISRVKNNSYTVLHAITPDNSL
AIGTEFELNGTYCTHTLLANSALAFHNASQSSIANHPCYINFQLEAYIGAPIRIGTDVFG
TVNFSSAQECAPFSDEAYDYIELLAQWLGSEFARNQDKVNLTKNSDTLLKLENVANIGTW
EVDLIDNSIFWSQQTRRIHQAEEGYTPNMETAIEFYKAGKSRDSINKAVENAVSKGEKWH
LELEIITAKQQNIWVSTFGEAEFNNGKCVRLFGTFQDITEAVKLREELKQKKALAEQLLQ
DRSMLFAKISHELRTPLNGITGMLATLIDEHDYDKRAEKIKVALRSADILLSIINEVLDF
SKINHGELKLEPHHSLLKTVFTDLVSLYSVLFSNKNIELLATNLIPNDVWVHCDTSRLSQ
IVSNLLSNALKFTEHGSVSLYSQLALDTKHPLLTIKITDTGRGMSKAYLNSLFKPFTQEV
DANNNKGGTGLGLAIVKELVGFMNGKIEVTSEINVGTCFTLTIPIELGKQQIQTPSLKSI
NNHGAKLSVLVVDDNEINRLVLEAALDKFNIKSDFAIDGQDAILKCKQKHYDLIFMDCIM
PILNGFEATKQLRSNNICSPKSTYIVALTANASSQDKLSCKQAGMDMFIAKPFKLPAIEE
AITNTLKRLSVATL
NT seq 2025 nt   +upstreamnt  +downstreamnt
gtgaattttcttcgatgctttcataatatagtctctgatcaacagcttagctttgatcaa
aaaattgcagacttacttgcttttgggctcgatgtttttcagctcgatttggctattatc
agccgcgtaaaaaataattcttacactgttttacatgctattacccctgacaattctctt
gctattggtactgagtttgagttaaacggcacctattgtacacatactttgttggccaac
tctgcactggcatttcataatgcgtcgcaaagtagtattgcaaatcatccttgctatatt
aatttccaattggaggcgtatattggagcgcctatacgaataggtactgacgtatttgga
actgttaacttttcatcagctcaagaatgcgccccttttagcgatgaagcttatgattat
attgaattattggctcagtggttgggctcagaatttgcgcgcaatcaggataaagttaat
ctcactaaaaatagtgacaccttattgaaacttgaaaatgttgccaatataggcacatgg
gaagtcgacctaatagacaatagcattttttggagccagcaaactcgacgtattcatcaa
gccgaagaaggctatactccaaacatggaaacagccattgaattttataaagcgggtaaa
agtcgagatagcattaataaggcggtagaaaatgcggtatctaagggtgaaaaatggcat
ttagagctggaaataattaccgcaaagcagcaaaatatttgggtgtcgacttttggggag
gccgagtttaacaacggcaaatgtgtgcgattatttggtacttttcaagatataactgaa
gccgttaagttacgcgaagagttaaaacaaaaaaaagcacttgcagaacaactcctccaa
gaccgtagtatgctgtttgccaaaattagtcatgagcttagaaccccgcttaatggtatt
acgggaatgttagcgactctcattgatgaacacgattatgacaagcgggcagaaaaaatt
aaagtcgcccttcgaagtgctgacattttattaagtattattaatgaagtactcgatttt
tcaaaaataaatcatggtgagttaaaactggagcctcaccactctctacttaaaacggta
tttaccgatttggtttctttatattcggtattgtttagtaataaaaacattgaactgcta
gccactaatctcattcctaatgatgtttgggtacactgcgacacctctcgattaagccaa
attgtctctaatttactaagtaacgcgttaaaatttacagagcatggatctgtttctctc
tattcgcaattagcattagacacaaaacaccctttacttaccattaaaataaccgacacg
ggtcgcggcatgagtaaagcgtatttaaactcattatttaagccttttacccaagaggtt
gatgctaacaacaataaaggcggcaccggattaggtttagcaattgttaaagaactcgtt
ggttttatgaatggcaaaattgaagtaacgagtgagattaatgtgggtacgtgttttacc
ttaactatcccgattgaacttggcaaacaacaaatacagacaccgagtcttaaatcgatt
aataatcatggtgccaaattatcagtactggtggttgatgataacgaaataaaccgcctt
gtgttagaagctgcgctggataagtttaatataaaatcagactttgccatagatggccaa
gacgcaattttaaagtgcaaacaaaagcattacgatcttatttttatggattgtattatg
ccaatacttaatggttttgaggctaccaaacaattaagatctaataacatttgtagcccc
aaaagcacatatatcgtcgctctgacggctaatgcttcttcccaagataaactaagctgt
aaacaagcgggcatggatatgtttatagccaaaccatttaagcttccagcaatagaagaa
gcaattacaaatacattaaaaaggctgagcgtagccacattataa

DBGET integrated database retrieval system