KEGG   Pseudoalteromonas sp. SM9913: PSM_B0328
Entry
PSM_B0328         CDS       T01374                                 

Definition
(GenBank) hypothetical protein
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Other DBs
NCBI-ProteinID: ADT70368
Position
II:complement(373474..373605)
AA seq 43 aa
MSDKTIPNRLLEVKIAFTHTPKAIEIIKYVYGERYSTCLSIHR
NT seq 132 nt   +upstreamnt  +downstreamnt
atgagcgataaaaccattccaaacagattgctcgaagtcaaaattgcatttactcataca
cccaaagctattgaaattataaaatatgtttatggtgaacgttactcaacgtgcttgagc
atacacaggtaa

DBGET integrated database retrieval system