KEGG   Pseudoalteromonas sp. SM9913: PSM_B0330
Entry
PSM_B0330         CDS       T01374                                 

Definition
(GenBank) transcriptional regulator, AraC family protein
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Motif
Pfam: HTH_18 HTH_AraC DJ-1_PfpI HTH_11
Other DBs
NCBI-ProteinID: ADT70370
Position
II:complement(374524..375183)
AA seq 219 aa
MVGLCLGAFVLAEAGILDGKTASTHWVWANDFAKKYPKVNFDNDVLYIDEGNVFTSAGAA
AAIDCCLHLLRRDHGADIANSVARRMVVAPHRSGGQVQYIEKPIPRHIDSNRLEPAITWA
LKNLTKPLTIDELASKASMSRRNFSRLFKKAMGTTFTQWLLSQRLTIAQQLLETSNHNID
RIANQSGFSSSVSFRQQFLAAFSISPSAYRKQFKSSEPQ
NT seq 660 nt   +upstreamnt  +downstreamnt
atggtaggtttatgtttaggcgcttttgtgcttgctgaagcaggtatattggatggcaaa
acagcatcaacccactgggtatgggctaacgacttcgcaaaaaaatacccaaaagtaaac
tttgataacgatgtactgtacattgatgaaggaaatgtttttacctcagcaggcgccgct
gccgcaattgattgttgcctacatttattacgtcgtgatcacggcgcagatattgccaac
agcgtggccagacgcatggttgtggcgcctcaccgcagtggaggacaagtacagtacata
gaaaaacccattcctcgacacatcgatagtaaccgtttagagccggctatcacttgggca
ctaaaaaatttaactaaacctttaacaatcgatgaactcgccagtaaagcaagtatgagt
cgccgtaatttttctcgactttttaaaaaagcaatgggcactacatttacacaatggctg
ctgagtcaacgtctaaccatcgcgcagcagctattagaaacaagtaaccacaatatagat
agaattgctaatcaatctgggttttcatcgagtgttagctttcgacaacagtttttagcc
gctttctctatttcaccttccgcttacagaaagcaatttaaaagtagcgagccgcaataa

DBGET integrated database retrieval system