KEGG   Pseudoalteromonas sp. SM9913: PSM_B0331
Entry
PSM_B0331         CDS       T01374                                 

Definition
(GenBank) isochorismatase hydrolase
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Motif
Pfam: Isochorismatase ACCA
Other DBs
NCBI-ProteinID: ADT70371
Position
II:375651..376238
AA seq 195 aa
MTTTLRELNGLDSTPASLTNATLIFVDYQNTYTQGVMELEGWQDALNNAAILLADARAAG
SKIIHIMHDGGEGSPYDINAEIGQIHSSVAPIADEKVIVKTAPDSFVGTGLGEQVDVIGN
NKLIIVGFMTHMCVTFTAQGAFLRGNHATVVADACATRPLQTSVSDVLASDLHKSALATI
NDLYGVVIPSADDLS
NT seq 588 nt   +upstreamnt  +downstreamnt
atgacgacgacacttcgtgaacttaatgggcttgactcaacacccgcttcacttacaaac
gccacacttatatttgttgattatcaaaatacttatacacaaggtgttatggagttagaa
gggtggcaagatgctcttaataatgcggcaattttactggctgatgcacgtgctgctggt
tctaaaattattcatattatgcatgatggtggtgaaggctcgccttacgatattaatgcc
gaaataggccaaatacactcaagtgtcgcgccaattgcggatgaaaaagttatcgttaaa
acagctcccgatagttttgtaggaacaggcttaggcgaacaagtagatgtaattggtaat
aataaattgatcattgttgggtttatgacccacatgtgtgtgacatttacagcgcaaggt
gcatttttaagaggtaaccacgcaacggtagtcgctgacgcgtgcgctacaaggccatta
caaacttcagtaagtgatgtgttggcatctgatctacataaaagtgccttagcaaccatt
aatgacttatatggcgtggttatcccaagtgctgatgacttaagctaa

DBGET integrated database retrieval system