KEGG   Pseudoalteromonas sp. SM9913: PSM_B0332
Entry
PSM_B0332         CDS       T01374                                 

Definition
(GenBank) GGDEF/GAF domain-containing protein
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Motif
Pfam: GGDEF
Other DBs
NCBI-ProteinID: ADT70372
Position
II:complement(376359..376754)
AA seq 131 aa
MCDIDFFKRYNDNYGHHKGDETLKHVARALKSLCKREGDIAARYGGEEFAIILPATNIEQ
CHKFALLIEQKIKALNITHEFSPIAPYITLSFGCFCSYPNADTHTETLIKSADIALYKAK
KAGRNQICIFE
NT seq 396 nt   +upstreamnt  +downstreamnt
atgtgtgatatcgacttttttaagcgctataacgacaattatggccaccacaaaggcgat
gaaacgttaaaacacgttgctcgtgctttaaaaagtttatgtaagcgtgagggtgacata
gcagctcgctatggcggtgaagaattcgcaatcattttacctgctacgaatatagagcaa
tgccataaatttgctttgttaattgagcaaaaaataaaagcgctgaatattacgcatgag
ttctctcctattgccccttacataacacttagctttggttgtttttgtagttatccaaat
gcagatacacacacagaaaccctaataaaaagcgctgacatagctttgtataaagcaaaa
aaagctggcagaaatcaaatatgtatttttgaataa

DBGET integrated database retrieval system