KEGG   Pseudoalteromonas sp. SM9913: PSM_B0334
Entry
PSM_B0334         CDS       T01374                                 

Definition
(GenBank) putative CzcD, Co/Zn/Cd efflux system component protein
  KO
K16264  cobalt-zinc-cadmium efflux system protein
Organism
psm  Pseudoalteromonas sp. SM9913
Brite
KEGG Orthology (KO) [BR:psm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psm02000]
    PSM_B0334
Transporters [BR:psm02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   PSM_B0334
SSDB
Motif
Pfam: Cation_efflux
Other DBs
NCBI-ProteinID: ADT70374
Position
II:378006..378899
AA seq 297 aa
MTEITTHHASRRRLLIALAITCSFMVIQLVGAYYANSLAVLADAGHLFVHNSSLFIALIA
SSFAIHLAKTYNDGHQKAELIGGLINGVLYLAISSLILYEGTERFMHHKGGHELVINSYL
MSVIAAIGFLFHGAAAWVLYKGRKASINVYAVFLHSFFDLISTVSTFAAGVLIYITGWNV
IDILSSMLIASFVLFTGIKVIISCLKGLRSNKAKLPKVADIETEITTMEHVANVHNVTVV
RKNKKVIVGAHVVLKQHCTIEKHDEECRLKVIKLLADKFNVRNSVLQIESYECKHIH
NT seq 894 nt   +upstreamnt  +downstreamnt
atgacagaaataaccacacatcacgcttctcgtcgccgtttgttaattgcacttgcaatt
acctgctcatttatggtgattcaattagtgggtgcgtattacgcaaactcacttgcagta
cttgctgatgcagggcatttgtttgttcataatagctctttgttcattgctctcattgcg
tctagctttgctattcatttagctaaaacctataacgatggccatcaaaaagcagagcta
ataggagggttgatcaacggcgttttatacctagccattagttcacttattttatatgag
ggcactgagcgctttatgcatcataaagggggacatgagctggttattaatagttactta
atgtcggtaattgctgctattggttttttatttcatggcgcggcggcatgggtgctttat
aaaggccgtaaggcgagcattaatgtgtatgccgtgtttttacactcgttttttgattta
atatcaacggtttctacttttgctgctggtgtacttatatacataacaggctggaatgta
attgatattttatcgagcatgttaattgcgtcttttgtcttgtttaccggtattaaggtc
attattagctgtctcaaggggttgcgttcaaataaagctaagttacctaaagtggccgat
attgaaacagaaataaccaccatggaacatgttgcaaatgtgcacaatgtcactgttgtt
cgtaaaaacaaaaaggttattgttggtgctcatgttgtgctaaaacaacactgtactata
gaaaaacatgatgaagagtgccgcttaaaggtaattaaactgcttgcagataaatttaat
gtgcgcaacagcgtattacaaatagaaagctacgaatgcaagcacatacactaa

DBGET integrated database retrieval system