KEGG   Pseudoalteromonas sp. SM9913: PSM_B0337
Entry
PSM_B0337         CDS       T01374                                 

Definition
(GenBank) putative isochorismatase family protein
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Motif
Pfam: Isochorismatase
Other DBs
NCBI-ProteinID: ADT70375
Position
II:383600..384154
AA seq 184 aa
MNYAGNIKAEHSILLVIDLQSKLAPAIASFNDTLDCALQLAKASAIHQIPSIITEHYKKG
LGESDEKIKSVLPNTRYFEKINFSACAQEGFLDILAQLNRPHIVVIGTEAHVCVLQTCLD
LLQQGYAVTVAADAVASRNTEHKAIALEQLRQAGAIVSCVETIIFQWTTKAGTSTFKQIL
PIVK
NT seq 555 nt   +upstreamnt  +downstreamnt
atgaattacgcaggaaatattaaagcagagcacagtatacttttagttatcgacttacaa
agtaagttagcaccagcgattgcttcgtttaatgacacgctagattgtgctctgcagtta
gcaaaagcaagtgctattcatcaaattccttcaataattacagaacattataaaaaagga
ctaggtgaaagtgatgagaaaataaaatctgtgttacctaatacacgctattttgaaaaa
attaactttagtgcctgtgcacaagaggggtttttagatattcttgcgcaattaaatcgc
ccacatatagttgtaattggcactgaagcgcacgtttgtgtgttacaaacatgcttagat
ttattacagcagggttatgcggtcactgtggcagctgatgcagtagcatcaagaaacaca
gagcacaaagctattgcactagaacagcttcgtcaagccggtgctatagtctcttgtgta
gagaccatcatatttcaatggacaacaaaagcagggacgtctacctttaaacaaatacta
ccaattgttaagtag

DBGET integrated database retrieval system