KEGG   Pseudoalteromonas sp. SM9913: PSM_B0338
Entry
PSM_B0338         CDS       T01374                                 

Definition
(GenBank) putative methyl-accepting chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
psm02020  Two-component system
psm02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:psm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PSM_B0338
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    PSM_B0338
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:psm02035]
    PSM_B0338
Bacterial motility proteins [BR:psm02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    PSM_B0338
SSDB
Motif
Pfam: MCPsignal DASH_Dad2 DUF1664
Other DBs
NCBI-ProteinID: ADT70376
Position
II:384285..385751
AA seq 488 aa
MSSVSRLFTIIFSLLFIESIGIGLYFGTLTEAFLVGLPLCLLPIWLLKTQPDSKMTPHVV
AAAIMMFSFLHIQQAYGLIEVHFEIFIFLAMLIMFIQWRVFITAIVFVAIHHLSFYYLQT
QNTGFYVFDPDRLAFSTVLIHAAYAIVEALVAGFIAVTLNRERRAGLSLSYATEQIMQDP
NQVKLSMRADDTTSKAVVGFNTLLEYLSDVIKQVQVQSDSLKNNSKELIHVHDELANSAQ
QRNAQTDDIANSGAQVAHGFKLVEQESDTLKQQVNSITESANVALEEVLQTDRKSTELLT
LLTNTEEQLSHLVAAGDVITSLLNEISGIADQTNLLALNAAIEAARAGEHGRGFAVVADE
VRSLANSSQATTTKIASTLTDLVNNSRTSTQSMNQCVEFVVDLTKISATMKENISSMSDQ
IQAVSASTNSVAQVVAEQAGNTEQIAMSTDQMRQNQYQEAKIVEQLTAKVQLIDVSIDVL
EQSIAKFK
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgtctagtgtaagtcggttattcacaattatttttagtcttttgtttattgagtctata
ggtattggtctttattttggcaccttgacagaagcatttcttgtcggcttaccgttatgt
ttgctccccatttggcttttaaaaacccaacccgatagcaaaatgacaccgcatgttgtt
gcggctgcaattatgatgttttcatttttacatattcaacaagcctatggccttattgaa
gtgcatttcgaaatattcattttcttagccatgctaataatgttcatacagtggcgagtg
tttattaccgctattgtgtttgtagctatacaccatttatctttttactatttgcaaaca
caaaacacggggttttacgtatttgatccagaccgactcgccttttcaacagtgcttatt
cacgcagcgtatgccattgtggaagcgcttgtagctggttttattgccgtaacgttaaat
cgcgaacgccgtgcgggtctatcgttaagttatgccacagagcaaataatgcaagatcca
aatcaagttaagctttctatgcgagcagatgacacaacaagcaaagcggtagttggtttt
aatactttgcttgagtacttatcagatgtgattaagcaagttcaagttcagtctgactct
ttaaaaaataactctaaagagcttattcatgttcatgatgagttagccaatagcgcgcag
caacgaaacgcgcaaacagatgatattgctaattcaggcgcacaagttgcgcatggtttt
aagttagttgaacaagaaagcgatactttaaaacaacaagttaatagcattactgaatca
gccaatgttgcgctggaagaagtattacaaaccgacagaaaaagcaccgagctactcacc
ttgttaacaaacactgaagagcagttaagccacttagtggccgctggggatgttattact
agtttactcaatgaaatttcaggcatagccgaccaaactaatttattagcccttaatgct
gcaatagaggccgcacgagcgggtgagcatggccgagggtttgctgttgttgccgatgaa
gtacgctcgcttgcaaatagcagccaagcaacaacaaccaaaatagcgtctacgcttaca
gatctggtaaataatagtcgcacgtcaactcagtcgatgaatcaatgtgtagaatttgtg
gttgatttaacaaaaataagcgcaacgatgaaagagaatatttcgtcaatgagtgatcaa
attcaagcggtatctgccagcactaactcagtagctcaagtggttgccgaacaggctgga
aatacagagcaaatagcaatgagtacagatcaaatgcgccaaaatcagtatcaagaggct
aaaatagttgagcagttaacggctaaagtgcagctgatagacgtaagtattgatgtatta
gagcaaagtattgcaaaatttaagtaa

DBGET integrated database retrieval system