KEGG   Pseudoalteromonas sp. SM9913: PSM_B0339
Entry
PSM_B0339         CDS       T01374                                 

Definition
(GenBank) conserved hypothetical protein
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Other DBs
NCBI-ProteinID: ADT70377
Position
II:385735..386259
AA seq 174 aa
MQNLSKSRYFTISLICIWLAFVVSALVYFQLGQLKPFDEGNMLKQQNWFSQFKNQVLWQN
KDSAQLVIITQENCGCTIQAQPHLSALQRFATNQGVEVQNFVLNNELKSVIPATPAAVLI
DKNGEFVYAGPLSEGLACSQGSGFVETVISNLQAGFNSSLLIADTKGCYCVNNA
NT seq 525 nt   +upstreamnt  +downstreamnt
ttgcaaaatttaagtaagtctcgttatttcaccattagcttaatttgtatatggcttgct
tttgttgtgtcggcacttgtttactttcagctagggcagctaaagccctttgatgagggt
aatatgcttaaacaacaaaactggttttcgcaatttaaaaaccaagtactgtggcaaaac
aaagacagtgctcaacttgtgattattacgcaagaaaattgcggctgtacaattcaagca
cagcctcatttatcagccctgcaacgctttgctacaaaccaaggcgttgaagtgcaaaat
tttgtattaaataatgagttaaagtcagtgatccctgccacacctgccgccgttttaatt
gataaaaatggtgagtttgtttatgcagggcctttatctgaagggctggcatgctctcaa
ggtagtggctttgtggaaaccgttattagtaatttacaggccggatttaactcatcatta
ttaatagcggatacaaaaggctgctattgtgtaaataacgcctaa

DBGET integrated database retrieval system