KEGG   Pseudoalteromonas sp. SM9913: PSM_B0340
Entry
PSM_B0340         CDS       T01374                                 

Definition
(GenBank) hypothetical protein
  KO
K23541  Ca2+/H+ antiporter, TMEM165/GDT1 family
Organism
psm  Pseudoalteromonas sp. SM9913
Brite
KEGG Orthology (KO) [BR:psm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:psm04131]
    PSM_B0340
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psm02000]
    PSM_B0340
Membrane trafficking [BR:psm04131]
 Endosome - Golgi transport
  Others
   Others
    PSM_B0340
Transporters [BR:psm02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   PSM_B0340
SSDB
Motif
Pfam: UPF0016 TauE TctB
Other DBs
NCBI-ProteinID: ADT70378
Position
II:complement(386366..386923)
AA seq 185 aa
MDIFLTSTVTVALAEIGDKTQLLSLLLAARFHNKIALILGILAATIINHGLSAWFGDWLS
GNFAVEYLPWIVNISFIVVGLWLLIPDKDEEVSHKYDRYGAFLVALILFFIAEIGDKTQI
ATVLLGAQYQSVLWVTVGTTVGMLIANVPVIYAGKALLKRIPLNTVRAIAASVFVLLGIY
GLVTI
NT seq 558 nt   +upstreamnt  +downstreamnt
atggatatttttttaacctctaccgtcactgttgcccttgctgaaataggcgataaaacc
cagcttttatctttactattagctgctcgctttcataataaaattgcacttattttaggc
attctcgctgctactattattaatcatggtttatctgcatggtttggtgattggctaagc
gggaactttgccgtcgaatacttaccttggatagtcaatataagctttattgtggtaggg
ctgtggctacttattccagataaagatgaagaagtgagccataaatacgaccgctatggt
gcatttttagtggccttaatcttattttttattgctgaaattggggacaaaacacaaatt
gcaaccgtattgctcggcgcacaatatcaatcagtactttgggttacggtgggtactaca
gtaggaatgttaattgctaatgtccctgttatttatgccggtaaggcgttactaaaaaga
attccattaaataccgtaagagcgatagcagccagtgtttttgtactgttgggtatttat
ggtttagtgactatataa

DBGET integrated database retrieval system