KEGG   Pseudoalteromonas sp. SM9913: PSM_B0341
Entry
PSM_B0341         CDS       T01374                                 

Definition
(GenBank) conserved hypothetical protein
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Other DBs
NCBI-ProteinID: ADT70379
Position
II:387288..387599
AA seq 103 aa
MQSTVVKSTMATIQNGVMKADGKFWITQTDLNFEPFNEKLGLEPYTIARDTILKVVECKG
KGAGLVPITADAIEVFTQDGSSYQFILSNPSDWINILSNQTSA
NT seq 312 nt   +upstreamnt  +downstreamnt
atgcaatcaacggtcgttaaatcaacaatggcaaccattcaaaatggagttatgaaagcg
gacggaaagttttggattacgcaaacagacttaaattttgaaccttttaatgaaaaatta
gggttagaaccatatacaattgcccgtgatacaattttaaaagtggttgaatgtaaaggc
aaaggcgcaggccttgttccaataacagctgatgcgatagaggttttcacgcaagatggc
agctcgtatcagtttatactctcaaaccccagtgattggataaatatattgtcaaatcaa
actagtgcttaa

DBGET integrated database retrieval system