KEGG   Pseudoalteromonas sp. SM9913: PSM_B0464
Entry
PSM_B0464         CDS       T01374                                 

Definition
(GenBank) putative sucrose phosphorylase
  KO
K00690  sucrose phosphorylase [EC:2.4.1.7]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
psm00500  Starch and sucrose metabolism
psm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PSM_B0464
Enzymes [BR:psm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     PSM_B0464
SSDB
Motif
Pfam: Alpha-amylase Malt_amylase_C
Other DBs
NCBI-ProteinID: ADT70501
Position
II:512189..513967
AA seq 592 aa
MNIVKELFFQRVEQHLHAIYQDVELPIAISELTEELITLILGDNPLRDPTPHTNRWDEQD
VVLIAYGDSIINHEDSDLAVGTPLEAPLKTLHRFIKEQCDHQLNALHILPFYPYSSDEGF
AVMNYAHVNEALGDWQDINAIAKDVKLMADLVINHCSSRSIWFENFLTDTHPGKDYFKTA
SLTDDLSQVVRPRTSPLLNTVTTTSGEKHVWCTFSHDQVDFDFENPEVLKEFVGIIRHYL
DNGIRLFRLDAVAFLWKQLNTSCINLPQTHEVVRLLRTLIEHAEPSVVIITETNIPNQEN
LSYFGNANEAHAIYNFALPPLLLHTLLSGDSTALKHWMMSMPPAQNGTAYFNFIASHDGI
GLRPIEGLLQPSEVASLVSTTMQFGGRVSMRTSHDGTHTPYELNIALFDALQGTHNGADK
FGLERFLCAHAIMFAMEGIPGLYIHSLLGTTNDYERFDNSQHNRAINRHRWQESKLLAAI
AEKYSHHHQVFNGVKQLLAVRKRQAAFHPNATQFTLHLGEGLFGFWRQSIDRQQSIFCIY
NISSQPQSLTLADLNLINTQQWYELLSKTVLDEELKTMQLAPYQTLWLSNRA
NT seq 1779 nt   +upstreamnt  +downstreamnt
gtgaatatagttaaagaacttttttttcaacgagttgaacaacatttacatgctatttat
caagatgttgaattaccgatagcaataagcgaattgactgaagaattgatcaccttaatt
ttaggtgataacccacttcgcgatcccacgccacacactaaccgctgggatgagcaagat
gttgtgctaattgcctatggcgattcgataataaaccatgaagacagtgatttagccgta
ggcacccctttagaggcgcctttaaaaaccttgcatcgctttataaaagagcagtgcgat
catcagcttaatgcactgcacattttacccttttatccgtatagctcagatgaaggattt
gcggtaatgaactatgcacacgttaatgaagcgctgggtgactggcaagacattaacgcg
attgcaaaagatgtaaaactgatggcggatttagtcattaatcattgctctagtcgaagt
atttggtttgaaaactttttaactgatacacaccccggaaaagattactttaaaacagcc
agtttaactgacgatttaagccaagtagttcgtcctcgtacatcgccactattaaatacg
gtaacaacaaccagtggtgaaaaacatgtatggtgcacatttagtcatgatcaagtggat
tttgattttgaaaatcccgaggtgttaaaagagtttgtcggcattattcgtcattattta
gacaacggtattcgcttatttcgccttgatgctgtggcctttttatggaaacaacttaat
accagttgtataaatttaccgcaaacccacgaagtagtacgtttattacgaacgctgatt
gagcatgccgagccaagtgtggtgatcatcaccgagactaatattcccaatcaggagaac
ttgtcttactttggtaatgccaacgaagcccatgcaatttacaactttgccttgccgccg
ttgttgttgcataccttacttagtggcgatagtacggcgcttaagcattggatgatgagt
atgccgcctgcacaaaacggcactgcgtattttaattttattgcttctcacgatggcatt
ggtttaaggccaattgaaggcttgctgcaacccagtgaggttgcttcattagtcagtacc
accatgcagtttggtgggcgcgtttcaatgcgtactagtcacgatggcacacataccccg
tatgagctaaatattgccttgtttgatgccttacaagggacgcataatggcgcggataaa
tttggccttgagcgctttttatgtgctcacgccattatgtttgcaatggaggggatccca
gggctgtatatacatagtttacttggcaccactaatgactatgaacgctttgataattcg
cagcacaatcgcgccattaaccgtcatcgctggcaagagtcaaaattattagcggcaatt
gcagaaaaatatagtcatcatcatcaagtattcaacggagtaaaacagttattagcagtg
cgtaaaaggcaagcggcatttcatcctaatgcaacacagttcactttgcatttaggagag
gggttatttggtttttggcgacaaagcattgaccgccagcaaagtattttttgtatttat
aatatcagcagtcagccacaaagcttaaccttggccgatttgaacttaataaatacacag
caatggtatgagctgctctctaaaacagtgctggatgaagagcttaaaactatgcaatta
gcaccgtatcaaacactctggttatctaatagagcataa

DBGET integrated database retrieval system