KEGG   Pseudoalteromonas sp. SM9913: PSM_B0511
Entry
PSM_B0511         CDS       T01374                                 

Definition
(GenBank) glycogen operon protein
  KO
K01214  isoamylase [EC:3.2.1.68]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
psm00500  Starch and sucrose metabolism
psm01100  Metabolic pathways
psm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PSM_B0511
Enzymes [BR:psm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.68  isoamylase
     PSM_B0511
SSDB
Motif
Pfam: CBM_48 Alpha-amylase GlgX_C
Other DBs
NCBI-ProteinID: ADT70548
Position
II:560105..562168
AA seq 687 aa
MSNCFEVTQGAPLPLGSSVQNQGVNFALYAPNASQAFVCLFDKSGHTEILKIAMNINEGG
VWSIHIAPLSTGALYGFRVDGEYSPEKGMLFNEHKLLIDPYAKDLFNEFTWSERHYGQMP
IGTKSVVNNAIDMPKSKVTAPVAYSNNKPQHSWANTVIYECHVKGATCRHPDIPKALQGT
FLGLSHPSFIEHLKSLGVTAIELLPVHAFISEQFLTAKGLQNYWGYNSLNFFTPHKDYLV
NDDINEFKQMVSELHRANIEVILDVVYNHTAEGGNDGPILSLRGLDNLTYYRTIEGQPNV
YINDTGCGNTLNIDHPKTLQLVLDSLRYWVEVMGVDGFRFDLATILARSNTGFSASHTFL
QAIAQDPVLNKVKLISEPWDIGPGGYQLGAFPSPWREWNDQYRDVIKRFWQSEKGIISDV
AKRLHGSFDIFEHSNRGPLNSINFITSHDGFTLADLVSYEQKHNQANGENNQDGHSANYS
FNCGIEGFTSDPEVMSLRLQQQKNFLLTLLLSKGVPMIAAGSEMAHSQGGNNNAYCQNNR
TSWLAWKDSQLNHSLIQFIDDALKIRRGHSAFKHSVFLDDIDERFTVKWFTEQGKKMDET
HWHEDTRQFLMYSLLDKQNKHALLIILNASKQPVVCQLPQSPIIAPWTLVLSSVNNASSV
IQEDATVNISAQSSWVFSANLEGDDYD
NT seq 2064 nt   +upstreamnt  +downstreamnt
atgagtaattgctttgaggttactcagggtgcgcctttgccactgggttcgagtgtacaa
aaccaaggcgttaactttgccttgtatgcccctaatgcaagccaagcttttgtgtgctta
tttgataaaagtggtcatacagaaatattaaaaatagccatgaatattaatgaaggcggc
gtatggagcattcacatagccccattaagcacaggcgcattgtatggctttagggttgat
ggcgaatacagcccagaaaaaggcatgttgtttaatgagcataaattactgattgatccg
tatgcaaaagacttgtttaacgaatttacttggagcgaacgtcattacgggcaaatgccc
attggcactaaaagcgtggttaataatgcgatagatatgcctaaatcaaaagtgactgcg
ccggttgcttattcaaataataagccacagcatagttgggccaataccgttatttatgag
tgccatgttaaaggtgctacctgtcgccatcctgatatccctaaagcgctacaagggaca
tttttaggtttgagtcatcccagttttattgagcatttaaaaagtttaggggtaacggct
attgagcttttgcctgtgcatgcttttataagcgaacagtttttaaccgctaaaggactg
caaaattactggggctataatagtcttaatttttttactcctcataaagactatttggtt
aatgacgatataaacgaatttaaacaaatggtgagtgagttacatcgcgccaatattgaa
gttattttggatgtggtatacaaccacaccgcagagggaggaaatgatggccctatttta
tctctgcgagggctcgacaacctgacatattatcgcaccattgaggggcaacccaatgtt
tatattaatgatacagggtgtggcaatacgttaaatatcgatcaccctaaaaccttacaa
ttggtactcgacagcttacgttactgggttgaagttatgggcgttgatggctttcgattt
gatttagccaccattttagcgcgttcaaatacgggctttagtgcgtctcacaccttttta
caagcaattgcccaagatcctgtgttaaataaagttaaactgatcagtgagccgtgggat
ataggccctggtggttatcagcttggtgcatttccttcaccttggcgagagtggaacgat
caatatcgtgatgtgattaaacgcttttggcaaagtgaaaaaggcattattagtgatgtc
gcaaagcgtttacatggctcgtttgatatttttgaacacagtaaccgaggcccgctaaat
agcattaactttattaccagccatgatgggtttacgttagccgacttagtcagttatgag
caaaaacataaccaggccaatggtgaaaacaaccaagatggccatagcgctaattattcg
tttaactgcgggattgagggatttaccagcgacccagaagtaatgagtttgcgcttacaa
caacaaaaaaactttctactcaccttattactctccaaaggcgtgccaatgatagccgct
ggcagtgagatggcgcactcgcaaggcggtaataataacgcttactgtcaaaataatcgc
accagctggcttgcctggaaagactcacaactgaatcattcattgattcagtttattgat
gatgcgctaaaaatcaggcgtggtcacagtgcatttaaacacagtgtgtttttggatgat
attgatgagcgcttcaccgttaagtggtttaccgagcaaggtaaaaaaatggatgaaaca
cattggcatgaagatacacggcaatttttaatgtatagcttacttgataagcaaaataag
catgcgttattaattattcttaatgctagtaaacagcctgtggtctgccaattaccacaa
tcgcccattatcgcgccatggacgttagtattatcaagtgtaaataacgcatcatctgtt
attcaagaagatgcaaccgtaaatatttcagcacaaagtagttgggtttttagtgccaat
ttagaaggcgatgattatgactaa

DBGET integrated database retrieval system