KEGG   Pseudoalteromonas sp. SM9913: PSM_B0512
Entry
PSM_B0512         CDS       T01374                                 

Definition
(GenBank) Phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
psm00500  Starch and sucrose metabolism
psm01100  Metabolic pathways
psm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PSM_B0512
Enzymes [BR:psm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     PSM_B0512
SSDB
Motif
Pfam: Phosphorylase
Other DBs
NCBI-ProteinID: ADT70549
Position
II:562161..564686
AA seq 841 aa
MTKQDEQVCVVKGWQAGPVIDESTLSDDLTRHFYYTLGRDVVGESQLYLYHALALTIRDR
LVARCRETNQQIKQQKRRKTAYLSLEFLMGRALGNAVLNLDLESQVTKALQAYCTELESV
EQAEHDAGLGNGGLGRLAACFLDSCASLALPVVGYGIRYEYGMFNQSIKEGNQVEQPDNW
LREGHPWELSAPEQAKRVKFSGYVQSYTDKFGREHRQWISSQDVLAVPYDVPIPGYKNNI
VNTLRLWKSEATDEFNLTEFNAGSYSEAVAQKNLAEQITMVLYPNDSSENGKELRLRQQY
FLSSASIQDVLTQWIEQYGNDFTEFAQHHVFQLNDTHPSIAVAELMRILVDDHELDWDQA
WNITTKTMAYTNHTLLPEALEKWSVSLFAKLLPRILEIIYEINARFLAEVAMHWPGDVQK
QRDLSLIEEGGEPQIRMAFLAIVGSYSVNGVAALHTQLLTAGLFKDFYALWPDKFNNKTN
GVTPRRWLAYCNPSLSQIISEKIGKDWIGDFAQISQLRRYYDDPQFHIKWQQAKQQNKQR
LVDLVKQRCGVEFDINMLFDVQVKRIHEYKRQLLNILHVIHLYDRIRRGDTQGMVPRCVL
LGGKAAPGYMMAKKIIKLINNVAEVINKDPQVSAFLRVAFLPNYNVTAMETICPATDLSE
QVSTAGKEASGTGNMKFMMNGALTIGTLDGANIEIRDAVGAENFFLFGAQAEHIDDIKAH
YNPSEIIANNPDLNSVMHLLESGHFNLFEPGLFDDVINGIKGNNDPWLTAHDFASYIAAQ
RDVDKAYADQTYWTQMSILNTAASGSFSSDRTISQYCDDIWHLTPLDTTHQTVKTNTDTN
S
NT seq 2526 nt   +upstreamnt  +downstreamnt
atgactaagcaagacgagcaagtgtgtgtagtaaaaggctggcaagcaggcccagtgatt
gacgaaagtactttaagtgatgatttaacacgacacttttattacaccttagggcgtgat
gtggtgggcgagtcacagctgtatttgtatcatgcattagcactgacgatcagagaccgg
ttagtggcacgctgtagggaaaccaatcaacaaataaaacaacaaaaacgccgtaaaaca
gcctatttatcgttagagtttttaatgggcagagcgctgggtaatgcagtattaaattta
gatttagaatcacaagttacaaaggcactgcaagcttactgtactgagcttgaaagtgtt
gaacaagctgagcatgatgccggtttaggcaatggcggcttagggcgactagcggcctgt
tttttagatagctgtgccagtttagcgctgccagtggtcggttacggtattcgttatgaa
tatggcatgtttaatcagtcaataaaagagggtaatcaggttgagcaaccagataactgg
ttacgagaaggtcatccttgggaattgagcgcaccggagcaagctaaacgggttaagttt
tctggttatgtacaaagctacaccgataaatttggccgtgagcatcgccaatggatcagt
tctcaagatgtattagcagtgccttatgatgtacctattccgggctataaaaataatatt
gttaatacccttagactttggaagtctgaagcaacggacgaatttaacttaacagaattt
aatgctggaagttattctgaagcggtagcacaaaaaaatctcgctgagcaaataaccatg
gtgttgtaccctaacgacagcagtgaaaatggtaaagagctgagattacgtcaacaatac
tttttatcatcggcaagtattcaagatgtacttacacaatggattgaacaatacggtaat
gattttactgaatttgctcagcatcatgtgtttcagcttaacgatacccacccaagtatt
gcggttgccgagcttatgcgaattttagttgatgaccatgaactggattgggatcaggca
tggaatatcaccaccaaaaccatggcttacacaaatcatactttactaccagaggcatta
gagaagtggtcggtatcgttatttgctaaattattaccgcgtattttagagattatttat
gaaattaatgcccgctttttagccgaggtggccatgcattggccaggtgatgtgcaaaaa
caacgggatttatcattaattgaagaagggggcgagccgcaaatacgtatggccttttta
gccattgtcggcagctattctgttaatggtgtggcagcactacacacgcagttattaacc
gcgggtttgtttaaagatttttatgcgctatggcctgataaatttaacaacaaaaccaat
ggtgttactccacggcgctggcttgcatactgcaatccgagtttaagccagatcattagc
gaaaaaataggcaaagactggataggtgattttgcacaaattagccaattacgtcgttac
tacgatgacccgcagtttcatataaagtggcagcaagcaaaacagcaaaacaaacaacgc
ttagttgatttagtaaaacaaagatgtggcgtagagtttgatattaatatgctatttgat
gtgcaggtaaaacgtattcacgaatataagcgccagttacttaacattttacacgttatt
catttatatgaccgcatacgccgtggcgacacacaaggtatggtgcctcgttgcgtttta
ttaggtggtaaagcagcaccgggttacatgatggctaaaaaaatcattaaactcattaat
aatgttgctgaggtgatcaataaagacccacaggtatctgcttttctaagagtcgcgttt
ttacctaattataatgtcaccgccatggaaaccatttgccctgcaacggacttatcggag
caagtgtcaacagcaggcaaagaggcctcaggtaccggcaacatgaagtttatgatgaat
ggcgcgctaacaataggcaccctagatggcgctaatattgaaatacgtgacgctgttggg
gctgagaacttcttcttatttggcgcacaagctgagcacattgacgacataaaagcgcat
tataaccccagtgaaataattgcgaataaccctgatttgaatagtgtgatgcacttactc
gaaagtggccatttcaatctatttgaacctggcttatttgacgatgtgattaatggcatt
aaaggtaacaacgatccttggttaaccgctcatgactttgccagctatatagctgcgcaa
cgtgatgttgataaagcctatgcagatcaaacctactggactcaaatgagtattttaaat
actgccgccagtggctcattttctagtgacagaacaattagtcaatattgtgatgatata
tggcatttaactccactagataccacacaccaaacagtaaaaacaaacactgacactaac
agctga

DBGET integrated database retrieval system