KEGG   Pseudoalteromonas sp. SM9913: PSM_B0513
Entry
PSM_B0513         CDS       T01374                                 

Definition
(GenBank) glucose-1-phosphate adenylyltransferase
  KO
K00975  glucose-1-phosphate adenylyltransferase [EC:2.7.7.27]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
psm00500  Starch and sucrose metabolism
psm00520  Amino sugar and nucleotide sugar metabolism
psm01100  Metabolic pathways
psm01110  Biosynthesis of secondary metabolites
Module
psm_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:psm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PSM_B0513
   00520 Amino sugar and nucleotide sugar metabolism
    PSM_B0513
Enzymes [BR:psm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.27  glucose-1-phosphate adenylyltransferase
     PSM_B0513
SSDB
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep
Other DBs
NCBI-ProteinID: ADT70550
Position
II:564707..565981
AA seq 424 aa
MPSYANRYISNLTRETYALILAGGRGSRLHELTDWRAKPAVYFGGKHRIIDFPLSNCINS
GVRRVGIATQYKSHSLIRHVNRAWGHFKKELGESVEILPASQRHGDEWYCGTADAVFQNM
DIIRHELPKYVMILSGDHVYRMDYGGLLAKHVENGADMTVCCLEVPVEEAAGTFGVMTVD
EESRVRRFDEKPAEPSSVPGKPGTCLASMGNYVFNTEFLFEQLQKDAQTEGSGRDFGHDI
IPAIIEEHNVFAYPFRDPAQVGQPYWRDVGTLDSFWEANMELVMPEPQLDLYDPTWPIWT
YQEQLPPAKFIFDDDDRRGMAVDSTVSGGCIVSGSLVRKSLLFSNVHIRSYCTIEESVIL
PGAIVNRGCKIKRAIIDRSCEIPPGLEIGFDRKTDEANGFRVSKKGIVLVTRDMLMKLDN
KSHR
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgcccagttatgcaaatcgttatataagtaatttaaccagagaaacctacgctttaatt
cttgccggaggtcgcggttctcgcttgcatgagctaaccgactggcgtgctaaacccgcc
gtttattttggtggtaaacatcgtattattgattttccactatcaaattgcattaactca
ggtgtaagacgtgtcggaattgcaacgcaatataaatcacactcactgattcgccatgta
aatcgtgcgtgggggcattttaaaaaggaattaggtgagtcagttgaaatattacctgcg
tcacagcgccatggtgatgaatggtattgcggtactgccgatgcggtatttcaaaatatg
gatatcattcgccatgagttacctaaatatgtgatgattttatctggcgaccatgtgtat
cgtatggattatggcgggctgttggcaaagcatgtagaaaatggcgccgacatgacggta
tgctgtttagaagtaccggttgaagaagctgcgggtacctttggtgtgatgacggttgat
gaagaaagtcgtgtacgtcgttttgacgaaaaacctgccgagcccagctcagtgcctggt
aaaccaggcacctgtttagcatcaatgggaaattatgtatttaatactgagtttttattt
gagcagctacaaaaagatgcgcaaacagagggctcagggcgtgattttggccatgatata
attcctgccattattgaagaacataatgtgtttgcctacccgtttagagatcccgcacaa
gtaggacaaccctattggcgcgatgtgggaactctagattcgttttgggaagcaaatatg
gaactagttatgccggagcctcaactggatttgtacgatcctacttggccaatttggact
taccaagagcaacttcctcctgccaaatttatttttgatgatgatgatcgccgagggatg
gcggttgactcaacggtgtcgggtgggtgtattgtttccggctcgttagtgagaaaatca
ttattattttctaatgtacatattcgttcatattgtaccattgaggagtcggttattttg
cccggtgctattgtaaatcgagggtgtaaaattaagcgagcaattatagatagaagctgt
gagatcccacctggattagagattggttttgatcgtaaaaccgatgaagccaatggattt
cgggtatcaaaaaaagggattgtattggtcacccgcgatatgctgatgaagttagacaat
aagtcacatcgttaa

DBGET integrated database retrieval system