KEGG   Pseudoalteromonas sp. SM9913: PSM_B0514
Entry
PSM_B0514         CDS       T01374                                 

Definition
(GenBank) Starch (glycogen) synthase
  KO
K00703  starch synthase [EC:2.4.1.21]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
psm00500  Starch and sucrose metabolism
psm01100  Metabolic pathways
psm01110  Biosynthesis of secondary metabolites
Module
psm_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:psm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PSM_B0514
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:psm01003]
    PSM_B0514
Enzymes [BR:psm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.21  starch synthase (glycosyl-transferring)
     PSM_B0514
Glycosyltransferases [BR:psm01003]
 Polysaccharide
  Storage polysaccharide
   PSM_B0514
SSDB
Motif
Pfam: Glyco_transf_5 Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_4_4
Other DBs
NCBI-ProteinID: ADT70551
Position
II:566040..567572
AA seq 510 aa
MHVLMVAAENDALPNAKVGGVADVIRDVPKALVAQGLTVDVVIPDYGFELGERCFIGEVS
VAFKSETHVLSLFEIPQNQKGVRQIVISHPLFSQSLSVYCNDNDNRPFATDATKFALFNA
AICEALIQGVLTQPNTLHLHDWHIACVAVLLKFNPRYGKLAKLRLVYTVHNLALQGIRPF
KGDDSSLEAWFPSLSYDGQRLCDPRYPHCFNPMRSAINLADKVHVVSPSYSQEVQIASND
AHGFFGGEGLERDLQQAAEQGKLIGILNGCDYAIQDEHEATYSQLLEQIESTLFSWMAKS
AQLHSSHYIAHQRVLQFMACDKQGPLVTSVGRLTEQKVLLLCQQQSKDLTIDSVCQIINQ
FKGRLLVLGSGDSKLEHLFTCAMARNNNFLFLKGYGQGVGDLMYQLGDLFLMPSSFEPCG
ISQMLAMRAGQPCLVHSVGGLKDTVEHNVSGFCFNGDTLSTQADALLQSLTEALSLYQTN
PKQWQAIKRRAADARFSWDSVVTDYITYLY
NT seq 1533 nt   +upstreamnt  +downstreamnt
atgcatgtattaatggttgctgcagagaatgatgcgttacctaatgccaaagttggtggt
gttgctgatgttattcgtgatgtaccaaaggcgttagtggcgcaggggctgacggtagat
gtggttattcctgattatggttttgaactaggtgagcgctgttttattggtgaagtgagt
gtggcatttaagtcagagacccacgttttatctttgtttgaaattccacagaatcaaaaa
ggagtgaggcaaatagttataagtcatcctctttttagtcaatcattgagtgtgtattgt
aacgacaacgataatagaccatttgctaccgatgcaaccaagtttgcactgtttaatgcc
gctatttgtgaagccctgatacagggcgtattaacacaacccaacacattacatttgcat
gattggcacattgcctgtgtggccgtgttacttaaatttaaccctcgttatggcaagctt
gctaagctgcgcttggtatatacggtgcacaatttagctttgcagggaattcgtcctttt
aaaggggatgattccagcttagaagcatggtttccctcgttaagttacgacgggcaacga
ttatgtgaccctcgttatccgcattgctttaaccctatgcgcagtgccattaatttagcc
gacaaagtacatgtggtttcaccgagttatagccaagaagtgcaaatagcaagtaatgac
gcccacggattctttggtggcgaaggacttgaacgagatttacaacaagcggctgagcaa
ggcaaattaattggcatactcaacggctgtgattacgcaattcaagacgaacatgaagca
acctatagtcagctattagagcaaatagaatcgactttgtttagttggatggcaaaaagc
gcgcaattacacagcagccactacattgcccatcagcgtgttttacaatttatggcgtgt
gataagcaagggccacttgtaacaagtgtagggcggctcactgagcaaaaagtattgtta
ctttgccagcaacaaagcaaagacctgactattgattcagtgtgtcagatcattaatcaa
tttaaggggcgtttacttgtacttggctcaggcgatagtaaacttgaacacctttttacc
tgcgccatggcacgtaataacaactttttgtttttaaaaggctatgggcaaggtgttggc
gatttaatgtatcaattaggtgatttatttttaatgccgagttcttttgagccctgtggg
attagccagatgctcgcaatgcgagccggccaaccttgcttagtgcacagtgtcggaggt
ttaaaagataccgtagagcataatgtcagtggattttgttttaacggcgatacgctaagt
acacaagctgatgcactcttgcagagtttaactgaggcacttagcctatatcaaacaaac
cctaagcaatggcaagcaataaaaaggcgagctgctgatgcacgatttagttgggatagt
gtggtaactgattatataacatacttatattaa

DBGET integrated database retrieval system