KEGG   Pseudoalteromonas sp. SM9913: PSM_B0577Help
Entry
PSM_B0577         CDS       T01374                                 

Definition
(GenBank) metalloprotease II
  KO
K05994  bacterial leucyl aminopeptidase [EC:3.4.11.10]
Organism
psm  Pseudoalteromonas sp. SM9913
Brite
KEGG Orthology (KO) [BR:psm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:psm01002]
    PSM_B0577
Enzymes [BR:psm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.10  bacterial leucyl aminopeptidase
     PSM_B0577
Peptidases and inhibitors [BR:psm01002]
 Metallo peptidases
  Family M28: aminopeptidase Y family
   PSM_B0577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M28 PPC Peptidase_M20 Peptidase_M42 PDGLE Sigma_reg_C
Motif
Other DBs
NCBI-ProteinID: ADT70612
Position
II:634036..635892
Genome map
AA seq 618 aa AA seqDB search
MNYFKQLAVITTLTLSFNCLANENPDNIWVTIDSTAAQHYHHEQGTFLQKMQFAHRKSSI
LPDVDLLSVPRDAVNNLSEFMHQNYNRCGGFVAHSSFEEANDYAKQLAVVQNSQATSAFN
YSIDNAQTVQSLISAQSPINLQSTVNSLTSFNNRYYTSQTGVDASQWLQSYWQQIASVRS
DITIESYQHSWAQSSVIVTIAGAENADEIVIIGGHLDSINQANPAQGRSPGADDNASGIA
VLTEALRAIVDTNYKPQKTIQIMAFAAEEVGLKGSKAIASSYRSLGKNVVGMVQFDMTGN
NGSIEDIIMMTDYTTNAQNQFLAQLIDTYLPQISYGFDQCGYGCSDHASWYQQGFAASMP
FESKMNDINPLIHTQNDSNFDADHAIKFANLAVSFVAELAKNAGDVTPPNNNELVNGEPI
SGINATAKEQLIYTLNVPKGAQNLSFETSGDNGDADLYVKYNQAPTLTDYDCKSTSATSN
ERCDIPTSNEGTYYVMVEAYSAISNVSLTGSFEPAGALEPINRVEDNVSVNTGGWQRFEQ
RLAAGYASLNVAISGGSGDADLYLNFGAPSSNTQFVCRPYKNGNTESCTISAPQAGVWHI
DVKGYRNASGITLTINAQ
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgaactactttaaacagttagcagttattactactttaaccttaagttttaattgctta
gcaaatgaaaatccagacaatatttgggtcaccattgactcaactgcagcccagcattat
catcatgaacaaggtacatttttgcaaaaaatgcaatttgcgcatagaaaatcaagtatt
ttacctgacgttgatttactcagtgtaccgcgtgacgcagtaaacaatttaagtgagttt
atgcaccagaactataaccgttgtggtgggtttgttgcgcatagttcgttcgaagaagcg
aatgattacgcaaaacaattagctgttgttcaaaatagccaagctacatcagcctttaat
tattcaattgataatgcgcaaacagtacaaagtttaattagtgcacaaagcccaattaat
ttacaaagcactgtaaattcactcactagttttaataatcgttattatacttcgcaaacc
ggcgttgatgcctcacagtggctgcaaagttattggcaacaaattgccagcgttcgaagt
gatataaccattgagagttatcagcatagctgggcgcaatcatcagtgattgtaaccatt
gcaggtgctgaaaatgcagatgaaattgttattattggggggcatttagactcgattaac
caagcaaatccagcacaagggcgctctcctggcgcggatgataatgcatcgggtattgca
gtgttaacggaagcgttaagagcaattgttgatacaaattataaaccgcaaaaaactatt
caaataatggcgtttgcagcagaggaggtggggttaaaagggtctaaagctatagccagt
agctatcgttcgctgggtaagaatgtagttggcatggtgcaatttgatatgactggtaat
aacggcagtatcgaagatattattatgatgacggattacaccaccaatgctcaaaaccag
tttttagcccagctgatagacacctacttaccacaaattagttatggctttgatcaatgt
gggtatggttgctccgatcatgcttcgtggtatcaacaagggtttgcggcctctatgcct
ttcgaatcaaaaatgaatgacattaacccactgatacatacacaaaacgacagtaatttt
gacgctgatcatgcaattaaatttgctaacttagccgttagctttgttgctgaattggca
aaaaatgccggtgatgtcactccgccaaataataatgagttagtcaatggtgaaccaatt
tctggtatcaatgccactgctaaagagcagcttatctatacattgaatgtaccaaaagga
gcgcaaaacttaagctttgaaacctcaggtgataatggcgatgccgatttatacgttaaa
tataatcaggcgcccacgttaactgattacgactgtaaaagtacctctgccacaagtaat
gagcgttgcgacattccaaccagcaatgaaggcacttactatgtcatggttgaggcatac
agcgcaattagtaatgtttctttgacgggcagttttgagccagcaggcgctttagagccc
attaatcgcgtagaagataatgttagcgtaaatacaggtggttggcagcgttttgaacaa
cgtttagccgcgggttatgcctcactaaacgttgctatttcaggcggaagcggcgatgct
gatttgtatttaaatttcggtgcgccatcttcaaatacacaatttgtgtgtaggccatat
aaaaacggcaacacagaaagttgcactatttctgcaccccaggcaggcgtatggcacata
gatgttaaaggctatcgtaatgcaagtggtattacgctaactataaatgcacaataa

DBGET integrated database retrieval system