KEGG   Pseudopedobacter saltans: Pedsa_0274Help
Entry
Pedsa_0274        CDS       T01430                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
psn  Pseudopedobacter saltans
Pathway
psn00010  Glycolysis / Gluconeogenesis
psn00620  Pyruvate metabolism
psn00640  Propanoate metabolism
psn00680  Methane metabolism
psn01100  Metabolic pathways
psn01110  Biosynthesis of secondary metabolites
psn01120  Microbial metabolism in diverse environments
psn01130  Biosynthesis of antibiotics
psn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pedsa_0274
   00620 Pyruvate metabolism
    Pedsa_0274
   00640 Propanoate metabolism
    Pedsa_0274
  Energy metabolism
   00680 Methane metabolism
    Pedsa_0274
Enzymes [BR:psn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Pedsa_0274
Lipid biosynthesis proteins [BR:psn01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Pedsa_0274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding ACAS_N AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ADY50859
UniProt: F0SEJ4
Position
328646..330553
Genome map
AA seq 635 aa AA seqDB search
MDLRIRSFEEYEKAYKHSVEQPEEFWAGVADNFLWRKKWDKVLNWNFKEPNIKWFEGGKL
NITENCLDRHLEERGDEPAIIWESNDPEEHHRILTYKNLHDKVSLFANVLKNNGAKKGDR
ICIYMPMVPELAIAVLACARIGAVHSVIFGGFSAQSIADRIQDAQCNIVVTADGSFRGTK
DVSLKSVMDDALVVCPSVQKVIVLTRSRTPVSMIKGRDVWWQDEINKVETLGLTECPAEE
MDAEDPLFILYTSGSTGKPKGVVHTCGGYMVYTGYTFRNVFQYNPGEVYFCTADIGWITG
HSYIVYGPLSQGATSLMFEGIPTWPDAGRFWDIVEKFKVNILYTAPTAIRSLMQYGTSFV
EGKDLSSLRVLGSVGEPINEEAWNWFNEEIGKKKCPIVDTWWQTENGGILISPLAGITPT
KPCFATLPLPGVQPVIVNEKGDILEGNGVEGNLCIKFPWPGMLRTTYGDHERCRTTYFAT
YDNMYFTGDGCLRDEDGYYRITGRVDDVINVSGHRIGTAEVENAINMFSDVIESAVVGYP
HDIKGQGLYAYVILAKEPTDVELTKKDISATVSRLIGPIAKPDKIQFVYGLPKTRSGKIM
RRILRKIAEGDLSNLGDTSTLLDPAVVDDIKDNRL
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atggatttgagaattagatcgtttgaagaatacgagaaagcgtacaaacatagtgtagaa
caaccagaagagttttgggctggtgttgccgataactttttatggagaaaaaagtgggac
aaagttcttaactggaactttaaggagcctaatatcaagtggttcgaagggggaaagctt
aatatcacagaaaactgtctggatagacatttggaagaaagaggagatgagccagccatt
atttgggaatcgaatgacccggaagaacatcacagaattttaacctataaaaaccttcat
gataaagtttcgctttttgcgaatgtattgaaaaacaatggcgcgaaaaaaggtgataga
atctgtatttatatgccaatggtgccggaattggcaattgccgtcttggcatgtgccaga
attggtgctgttcattcggtaatttttggaggattttctgcccaatctattgccgacaga
atccaggatgcacagtgtaatattgtagtaactgcagatggctctttcagggggactaaa
gatgtaagcttaaaaagcgttatggatgacgcattagttgtatgtccgtcggttcaaaaa
gtaattgtactaaccagaagccgtactccggtttcgatgataaaaggccgtgacgtttgg
tggcaggatgaaatcaataaagtagagactttggggttgacagaatgccctgcggaagaa
atggatgcagaagatccattgtttatactttatacttcgggctctacaggaaagcccaaa
ggtgtagtgcatacctgcggtggatatatggtttacaccggatacactttccgaaatgtt
tttcaatataatcctggagaggtttatttctgtactgcagatattggttggattacgggg
cattcttacattgtatacggaccattgtctcaaggggcaacttctttaatgtttgaaggt
attcctacgtggccggatgccggtagattttgggacatcgtagaaaaattcaaagttaat
atattatatacagcacctacggcaatcagatcgttgatgcaatatggaaccagtttcgta
gagggaaaagatttaagttctttacgcgttctgggttcggttggcgaaccaattaacgag
gaggcctggaattggtttaacgaagaaatcgggaagaaaaaatgtccaattgtagatacc
tggtggcagacggaaaatggcgggattttaatttctcctttggcaggaataacgccaact
aaaccatgttttgctactttacctttacctggggttcagcctgttatagttaacgagaag
ggagatatattagaggggaatggtgtagaaggtaatttgtgcataaaattcccttggccg
ggtatgttaagaactacatatggagatcatgagcgttgcagaacaacttattttgcgact
tatgacaatatgtattttacgggagatggttgtttaagagatgaggatggttactataga
attacgggaagggtagatgatgtaattaacgtttctggacaccgaattggaacggccgaa
gtagaaaacgcgattaacatgttttctgatgtgattgaatctgcggtagtaggttatcca
catgatattaaagggcagggattgtatgcttatgttattttagctaaagaaccaaccgac
gtagagctgacgaaaaaagatatttcggcaacagtcagcagattaattggcccaatagct
aaaccggataaaattcaattcgtgtatggtttgccaaaaaccagatcggggaagattatg
cgtagaattttgaggaaaatagcggaaggggacttgtctaatttaggagacacttccact
ttactggatccggccgtagtagatgatataaaggataatcgtttataa

DBGET integrated database retrieval system