KEGG   Pseudopedobacter saltans: Pedsa_1417Help
Entry
Pedsa_1417        CDS       T01430                                 

Definition
(GenBank) catalytic domain-containing protein of components of various dehydrogenase complexes
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
psn  Pseudopedobacter saltans
Pathway
psn00020  Citrate cycle (TCA cycle)
psn00310  Lysine degradation
psn01100  Metabolic pathways
psn01110  Biosynthesis of secondary metabolites
psn01120  Microbial metabolism in diverse environments
psn01130  Biosynthesis of antibiotics
psn01200  Carbon metabolism
Module
psn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:psn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pedsa_1417
  Amino acid metabolism
   00310 Lysine degradation
    Pedsa_1417
Enzymes [BR:psn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Pedsa_1417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: ADY51982
UniProt: F0S4J1
Position
complement(1666703..1668088)
Genome map
AA seq 461 aa AA seqDB search
MAQYKFILPKMGESVAEATIINWLKKPGDAIEIDDTVLEVATDKVDSEVPSPVKGILIET
FFKENDVVQIGDVIATIEISEGDVEETAVKQEDELPIQNYNDIEEVEIPYIPSEEVDQIN
TSQNEYSDSNRFYSPLVKSIASEEGISLSELDSIQGSGADGRVTKDDLLAYVNKRNGKSY
PIEAQVSVTPEIRQAEAKDTKQSDRTEISVSEEKTYKQQHVVASSGSDEIIEMDRMRRLI
SDHMVMSKETSVHVTSFVEADVTNLVKWRDKVKSGFEKREGEKITFTPIFIEAIAKAIKD
FPMINISVQDNKIIKKKDINIGMAAALPNGNLIVPVIKNADQLNLVGLTKSVNDLGKRAK
VNKLAPDEIQGGTFTMSNIGMFGNIMGTPIINQPQVAILAVGVIKKKPAVIETEYGDVIA
IRHMMYLSMSYDHRVVDGSLGGMFLRKVADYLEQWDSDREI
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggctcagtacaaatttatattgccgaaaatgggggaaagtgttgctgaagcgacaatt
atcaactggctaaaaaagccgggagacgccatagaaatagacgatacggttttagaagtg
gcaactgataaagttgactcggaagttccgtctccggttaaagggatattgattgagacc
ttttttaaagaaaatgatgtagttcagataggtgatgttatagcgactattgaaataagc
gagggcgatgttgaagagacggctgtaaagcaggaagatgaactaccgatacaaaattat
aatgatattgaggaggtagaaattccatatattccttccgaagaggtagaccagataaat
actagccagaatgagtacagtgattcgaatagattttactcaccattggttaaaagtatt
gcatctgaagagggaatttctttaagcgaattggattcgatacaaggtagcggggcagat
ggtagagtaaccaaggacgatttattggcttatgttaataaaagaaacggaaaatcgtat
ccaatagaggctcaggtttctgttacacccgaaatcaggcaagcagaagcaaaagatact
aagcaaagcgatagaacagagatttctgtatcggaagagaaaacttacaaacaacagcat
gttgttgcaagttctggttcagatgagattatagagatggacagaatgagaagattgatt
tctgaccatatggtaatgagtaaagagacatcggttcatgttacctcatttgtagaagcc
gatgtgaccaatttagtgaagtggagagataaagttaaaagtggtttcgaaaaaagagaa
ggagagaagattacctttactccaatttttattgaagctatagcaaaagcaatcaaagat
tttccgatgattaatatttccgttcaggataataaaatcatcaagaaaaaagatataaat
attgggatggctgcagctttaccaaatggaaatctaattgtaccggttattaaaaacgcg
gatcagctgaatttggttggtttgacaaaatctgttaatgatttaggtaaacgcgcaaaa
gttaataaattggcaccggatgaaattcagggcggaacattcacgatgagtaatatagga
atgtttggtaatattatggggactcctataatcaatcaaccgcaggtagctattttagct
gtaggggttatcaagaagaagccagcagttatagaaactgagtatggggatgtaattgcc
ataaggcatatgatgtatttatccatgtcttatgaccacagggtggtagacggttcctta
ggaggtatgttcctgcgtaaggttgccgattatctggaacagtgggatagcgaccgggaa
atttag

DBGET integrated database retrieval system