KEGG   Pseudopedobacter saltans: Pedsa_1915Help
Entry
Pedsa_1915        CDS       T01430                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
psn  Pseudopedobacter saltans
Pathway
psn00240  Pyrimidine metabolism
psn00250  Alanine, aspartate and glutamate metabolism
psn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psn00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Pedsa_1915
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Pedsa_1915
Enzymes [BR:psn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Pedsa_1915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace DUF4431
Motif
Other DBs
NCBI-ProteinID: ADY52468
UniProt: F0S9B8
Position
2245869..2246807
Genome map
AA seq 312 aa AA seqDB search
MAELAQRLSTRHLLGIKDLNKNDIELILETADTFKDVINRPIKKVPSLRDITIANIFFEN
STRTKLSFELAQKRLSADIINFAASSSSVSKGETLIDTVNNILSMKVDMVVMRHPYPGAG
IFLSKHIDAQIVNAGDGAHEHPTQALLDAFSIREKYGEVAGKKVVIVGDILHSRVALSNI
LCLQKLGAEVMVCGPTTLIPKYINTLGVKVEHNLRKALNWCDVANMLRIQLERQDIKYFP
SLREYSMMYGLNKEILDSLDKEITVMHPGPINRGVEITSDVADSKQSIILNQVENGVAVR
MAVLYLLASQKD
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggcagagctagcacaaaggttaagcacaagacatcttttaggaattaaggatctaaac
aagaatgatattgagctgatattagaaactgccgatacttttaaagacgttatcaacagg
ccgataaaaaaagtgccttctttaagagacatcaccattgcaaatatctttttcgaaaac
tcgacaagaacaaaactatctttcgagcttgctcaaaaaagactttctgccgatatcatc
aattttgcagcatcaagttcttctgtaagcaaaggagaaacacttattgatacggtgaat
aacattttatctatgaaagtggatatggtagttatgagacatccttacccaggtgcaggt
atatttctaagtaaacacattgatgctcagattgtaaacgccggagatggtgcacacgaa
caccctacccaggctttattggacgctttctctataagagaaaaatatggcgaagttgca
ggaaaaaaagtagttattgtaggtgatatattacattccagagtagctttgtcgaatatt
ttatgtctgcagaaactaggagctgaagtgatggtttgcggacctactacactaattcct
aaatacatcaacacattaggtgtaaaagtagaacacaatcttagaaaagctttaaactgg
tgcgatgtagcgaatatgcttcgtatacaactggaaagacaggatattaaatacttccct
tcacttcgtgagtattctatgatgtatggactgaataaagagatattggattcattagat
aaagaaattacggtaatgcatcccggtccaattaataggggtgtcgaaattaccagcgat
gttgccgacagtaagcaatctatcatattaaaccaggtagaaaacggagttgccgtaaga
atggcggttctttatttactggccagccagaaagattaa

DBGET integrated database retrieval system