KEGG   Pseudopedobacter saltans: Pedsa_1950Help
Entry
Pedsa_1950        CDS       T01430                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
psn  Pseudopedobacter saltans
Pathway
psn00471  D-Glutamine and D-glutamate metabolism
psn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Pedsa_1950
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:psn01011]
    Pedsa_1950
Enzymes [BR:psn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     Pedsa_1950
Peptidoglycan biosynthesis and degradation proteins [BR:psn01011]
 Precursor biosynthesis
  Racemase
   Pedsa_1950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: ADY52503
UniProt: F0S9F3
Position
complement(2286430..2287242)
Genome map
AA seq 270 aa AA seqDB search
MIAEQPIGIFDSGIGGLTVANAIRKVLPKEKIIYFGDTGHMPYGDKSPDAIRYYSLKIGK
FLEEKGCKVIVIACNTASSLAYDDLVQFMGDRIPILNVIDPVVHYVTDDMQYQKIGVIGT
KATISSDVYARKLKERNLGLQVNSLATPLLAPMIEEGFFENNISHTVIESYLSSPQLQNI
DALILACTHYPLIKREIESFFNNQVDILNTASIVADDVKLQLEKLQLLNNQSLDYKDEFY
VSFKTPSFECSTKIFFGDQIELIQKNIWVK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgattgcagagcagccaataggcatttttgattcgggaattggaggattaacagtagca
aatgctattagaaaagtactacctaaggagaagattatttattttggagatacgggtcat
atgccatatggagataagtctccggacgctatcaggtactacagcttgaaaattggaaag
tttctggaagaaaaaggttgcaaagttatagttatagcatgtaacacggcttcgtcttta
gcttatgatgatttggtgcagtttatgggtgatagaataccaattttaaatgtaattgat
cctgttgtacactacgtaacagacgatatgcaatatcagaagataggtgtaattggcacc
aaagcaactatcagttcagatgtttacgctagaaagttaaaagagagaaacctcgggctt
caggtcaattctttggctacgccattactggctcccatgatagaagaaggcttttttgaa
aataacatcagtcatacggtaattgagtcttatctgtcttcccctcaattacagaatata
gatgctttgattctggcgtgtacacattatcctttgataaaaagagagatagaaagtttt
tttaataatcaggttgatattctaaatacagcatctattgtagcagatgatgttaaattg
caattggaaaaattacaattgcttaataatcagtcattagactataaagatgagttttac
gtgtcgtttaaaacgccatcgtttgaatgtagtacgaagatctttttcggtgaccaaata
gaattaattcaaaaaaacatttgggttaagtag

DBGET integrated database retrieval system