KEGG   Pseudopedobacter saltans: Pedsa_2660Help
Entry
Pedsa_2660        CDS       T01430                                 

Definition
(GenBank) homoserine O-succinyltransferase
  KO
K00651  homoserine O-succinyltransferase/O-acetyltransferase [EC:2.3.1.46 2.3.1.31]
Organism
psn  Pseudopedobacter saltans
Pathway
psn00270  Cysteine and methionine metabolism
psn00920  Sulfur metabolism
psn01100  Metabolic pathways
psn01110  Biosynthesis of secondary metabolites
psn01130  Biosynthesis of antibiotics
psn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:psn00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Pedsa_2660
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Pedsa_2660
Enzymes [BR:psn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     Pedsa_2660
    2.3.1.46  homoserine O-succinyltransferase
     Pedsa_2660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTS
Motif
Other DBs
NCBI-ProteinID: ADY53202
UniProt: F0S688
Position
complement(3145527..3146474)
Genome map
AA seq 315 aa AA seqDB search
MPVKIPNNLPAIELLKKENIFVMNDLRANTQDIRPMRVLILNLMPIKITTETDFVRLLSN
NPLQVEVEFLRLDSHKSKNTSEEHLELFYKSFDEIKGNFYDGMIITGAPVEMLKFEEVNY
WNEITTIFDWARKHVTSTLYICWASQAALYHFYGVEKVPLDDKLFGVFKHTATDKTNPLF
RGFDDEFFIPHSRHTTFFKSDVENKADITVLSESKEAGVAIASSRGGREFYLTGHSEYAP
LTLHDEYMRDVNRGLEIDVPRNYYVDNDPKKGPLVCWTSHANLLFNNWLNYFVYQETPYD
LRDVEHLGDIKASND
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgccagtaaaaataccgaataatctgccagcgatagagcttctgaaaaaagaaaacatt
tttgtgatgaacgacctaagggcaaacactcaggacattcgtccaatgcgtgtattgatc
ctgaacctgatgcctataaagataacgacggagactgattttgtgcgtttactttctaat
aatccgttgcaggtagaggtggagtttttgagactggattctcataaatccaaaaatacg
tctgaagagcatttggaattgttttacaagagcttcgacgagattaaagggaatttttat
gatggtatgattattaccggtgcgcccgtagaaatgttgaagttcgaagaggtaaactat
tggaacgagattacgactatatttgactgggccagaaaacatgttacgtccactttatat
atttgttgggcttcgcaggctgcattgtatcatttctatggtgtagagaaagtgcctttg
gatgataaattgtttggtgtttttaagcatactgcgacagataagacaaaccctttattt
aggggctttgatgatgaattctttattccacatagcagacataccactttctttaagtct
gatgtagaaaataaagcggatattactgtgctttctgaatctaaagaagccggagttgct
attgcatcttcgagaggaggcagggagttttatctgaccggacattcggaatatgcacct
cttacattacacgatgaatatatgagagatgtgaacagaggacttgaaattgatgttcca
cgaaattattatgtggataacgatcctaaaaaagggcctttggtctgctggacaagccat
gcaaacttattattcaataactggcttaactattttgtatatcaggagactccgtatgat
ttacgtgatgtagaacatttgggagatataaaagctagtaatgattag

DBGET integrated database retrieval system