KEGG   Pseudopedobacter saltans: Pedsa_2744Help
Entry
Pedsa_2744        CDS       T01430                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
psn  Pseudopedobacter saltans
Pathway
psn00230  Purine metabolism
psn01100  Metabolic pathways
Module
psn_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:psn00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Pedsa_2744
Enzymes [BR:psn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Pedsa_2744
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 AAA_16 AAA_22 AAA RNA_helicase RsgA_GTPase HAS-barrel Rad17 cobW TsaE UPF0489 ABC_tran AAA_25 T2SSE
Motif
Other DBs
NCBI-ProteinID: ADY53285
UniProt: F0S722
Position
complement(3277515..3278084)
Genome map
AA seq 189 aa AA seqDB search
MKQGKLIIFSAPSGAGKTTIVHHLLNKFPDKISFSISATTRSARGQEVDGKDYYFISNED
FLHKVAKHEFVEFEEVYTGTFYGTLKSEIQRIWDEGKHVIFDIDVEGGLRLKKKYGENAL
AIFVQPPSLDVLKQRLAGRGTDSEEKLKERFAKAEKELAYSPKFDVQLKNFDLEIACKEA
EDLLLNFIG
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaggtaaattaatcatattttctgcgccgtcgggagcaggtaaaaccactata
gtacatcatctattaaataaatttccagataaaatatccttctccatatccgcgacaacc
agaagtgccagagggcaggaagtagacggaaaagattattattttattagtaatgaagac
tttctacataaagtagccaaacacgagtttgtagaatttgaagaagtttataccggcaca
ttttacggaacattgaaaagtgagattcaaaggatatgggacgaaggcaagcatgtgatt
tttgatattgatgttgaaggtggcttgcgtttgaaaaaaaaatatggagagaatgcttta
gccatatttgtacaacctccgtctcttgatgttttgaaacagcgtctggctggaagaggt
accgattctgaagagaaattaaaagagcgttttgctaaggcagaaaaagaactggcttat
tcgcctaaatttgatgtgcaattgaaaaacttcgatttagaaatagcttgtaaagaagca
gaagatttgttgttaaattttatcggataa

DBGET integrated database retrieval system