KEGG   Pseudopedobacter saltans: Pedsa_2853Help
Entry
Pedsa_2853        CDS       T01430                                 

Definition
(GenBank) ROK family protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
psn  Pseudopedobacter saltans
Pathway
psn00010  Glycolysis / Gluconeogenesis
psn00520  Amino sugar and nucleotide sugar metabolism
psn01100  Metabolic pathways
psn01110  Biosynthesis of secondary metabolites
psn01120  Microbial metabolism in diverse environments
psn01130  Biosynthesis of antibiotics
psn01200  Carbon metabolism
Module
psn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:psn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pedsa_2853
   00520 Amino sugar and nucleotide sugar metabolism
    Pedsa_2853
Enzymes [BR:psn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Pedsa_2853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: ADY53392
UniProt: F0S8C8
Position
complement(3398515..3399264)
Genome map
AA seq 249 aa AA seqDB search
MDKQQTLAIDIGGSSIKATVLDEQGEMLAEYQKTPTPKVPKPEAVLQSIKNLVVGFPEFN
QVTVGFPGYVRAGIVQTAPNLGTKYWEGYPLAQSLADEFGQPVRLLNDADLQGFGLIEGK
GLELVLTLGTGLGTALFMDGSLLPHLELSHFIAKDDKDFDAYIGDKALDKDGTEKWNKKL
KEVIALFSLVVNYNKLYLSGGNAKKVELKLDHNIKICGNREGIKGGAFVWKAEENFSLKT
VKPNTQHNK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggacaaacaacaaactttggcaatagatatcggtggttcaagcattaaagcaacggtt
ttggatgagcagggagagatgttagcagaatatcagaaaacgccaacgccgaaggttcca
aaaccagaggctgttttacagagtatcaaaaacttagttgttggatttccagagtttaac
caggtaacagtaggttttcccggatatgttagagccggtatagtgcagactgcaccaaat
ctcggtaccaaatactgggaaggttatcctctggcacagtcgcttgcagatgaatttggc
cagccagtacgccttttaaacgatgcggatttacagggttttgggctgatagagggtaaa
ggccttgagctggttcttactttaggaacgggcttgggaacggcactatttatggacgga
tctctattgcctcaccttgaattatcgcattttatagcaaaagacgataaagactttgac
gcctatataggcgacaaggccctggataaggatggtacagaaaaatggaataaaaagctg
aaggaggtaattgcgctttttagtctagtagttaattataataaactttatcttagcggc
ggcaatgccaaaaaggtagaactgaagcttgatcacaatatcaagatatgtggaaacagg
gaagggataaaaggaggagcttttgtatggaaagcagaggaaaatttttcactaaagaca
gtcaaaccaaacacacaacataataagtag

DBGET integrated database retrieval system