KEGG   Pseudopedobacter saltans: Pedsa_3001Help
Entry
Pedsa_3001        CDS       T01430                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
psn  Pseudopedobacter saltans
Pathway
psn00010  Glycolysis / Gluconeogenesis
psn00030  Pentose phosphate pathway
psn00051  Fructose and mannose metabolism
psn00052  Galactose metabolism
psn00680  Methane metabolism
psn01100  Metabolic pathways
psn01110  Biosynthesis of secondary metabolites
psn01120  Microbial metabolism in diverse environments
psn01130  Biosynthesis of antibiotics
psn01200  Carbon metabolism
psn01230  Biosynthesis of amino acids
psn03018  RNA degradation
Module
psn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:psn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pedsa_3001
   00030 Pentose phosphate pathway
    Pedsa_3001
   00051 Fructose and mannose metabolism
    Pedsa_3001
   00052 Galactose metabolism
    Pedsa_3001
  Energy metabolism
   00680 Methane metabolism
    Pedsa_3001
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Pedsa_3001
Enzymes [BR:psn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Pedsa_3001
Protein phosphatases and associated proteins [BR:psn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Pedsa_3001
Messenger RNA biogenesis [BR:psn03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Pedsa_3001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat DUF3906 Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: ADY53540
UniProt: F0S9I7
Position
complement(3548009..3548983)
Genome map
AA seq 324 aa AA seqDB search
MISRINKIGILTSGGDSPGMNAAIRAVVRTALYYDLDVIGIRRGYEGAINGEFIEMDRKS
VANIIQRGGTILKTARSQAFQTPEGRKKAYDQIKAQGIDALVVVGGDGTFTGAKVFGEEF
DIPIIGLPGTIDNDLYGTDFTIGYDTAINTAVDAVDKIRDTAESHDRVFIIEVMGRDCGL
IALRSGIGVGAEAILIPETKTDVPHLLHRMEVGRKDKSSKIIMVAEGGEGAFKLGEIIKE
RFPHYDTRVSVLGHIQRGGKPTCMDRVLASRLGVAAVEGLLEGRRDVMAGLIHGKVEFTP
LDHAIKHNKEVNESLLKIVEILSL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgattagcagaataaataaaatagggatacttacttctggaggggactctccgggcatg
aatgcggcaattagggcggttgtacgtacagcattatattatgatttggatgttataggt
ataagaagaggatacgagggagcaatcaatggtgaatttattgaaatggaccgaaagtct
gtagctaatattatccaaagaggaggaactatactcaaaaccgcaagaagccaggcgttc
caaacgccggaggggagaaaaaaagcttacgatcaaattaaagctcagggaatagacgct
ttggttgttgtaggtggagatggtacttttaccggggcaaaggtttttggcgaggaattc
gatattccaattattggtttgccgggaacaattgataacgatttgtacggaacagatttt
acaattggttatgacacagcgataaatacagccgtggatgctgtagataaaatcagggat
accgccgaatctcatgatagggtttttataattgaggtaatgggacgtgactgtggttta
atcgcgttaaggagtggtattggtgttggtgccgaggctattttgattcctgagacaaaa
actgatgttccgcatttgttgcacagaatggaagttgggcgtaaagataaatcttctaaa
attattatggttgcagaaggtggagagggagcttttaagttgggagaaattattaaagag
agatttccacactacgataccagggtgtctgtgctaggacatattcagagaggcggaaaa
cctacttgtatggatagagttttggctagtcgtttaggtgtagctgccgtagaaggattg
ttagaaggaagaagagatgtaatggcgggattaattcacggaaaggtagaatttacaccg
ctggaccatgcaattaaacataacaaagaggttaacgaaagcttattgaaaattgttgag
attctatctctataa

DBGET integrated database retrieval system