KEGG   Pseudarthrobacter sp. NIBRBAC000502771: NIBR502771_03740Help
Entry
NIBR502771_03740  CDS       T06121                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
psni  Pseudarthrobacter sp. NIBRBAC000502771
Brite
KEGG Orthology (KO) [BR:psni00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    NIBR502771_03740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: QDG61509
UniProt: A0A4Y6QM25
Position
783988..784998
Genome map
AA seq 336 aa AA seqDB search
MAAVIFGAVVLLAAAFAFLNGFRDASTSVALAVRNRALTPSVGILLAAFFNFVGALLSAL
LAVAVSRTWISLPAGTDGLSILVAGLASACAWGILMWWRGIPASSTHALVGGLAGAGLAS
LAIGGPGVAGVDQSLLFQVVLPLVLSPLVAYSGSFLLVYPATWVARYTQANVVNQRFRRG
QAVAAGAVAFGHGLQDGQRVSAVLLLALLAAGYADGGIPTWVAGLCAVMMTAGTLFGGWR
ISHTIGYKITRIDPLRGSVAQTFSAVMLFVGAIGLHWPLSTTHTVTAGALGAGENQHFSV
TNRKLVIRILWLWGLTPLATCVLGFVLALALSPIST
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gtggcggcagtcatcttcggcgcggtggtcctgctggccgcggcgtttgccttcctgaac
ggcttccgcgacgcatccacctcggtggccctggcggtgcggaaccgggccctcaccccc
agcgtgggcatcctcctggccgcgttcttcaactttgtcggcgccctcctcagcgccctg
ctcgccgtcgccgtcagccggacctggatcagcctccccgccggcaccgacggactgtcc
atcctggtggccggcctggccagcgcgtgcgcatggggcatcctgatgtggtggcgcggc
attcccgcgtcctccacccacgccctggtgggcggccttgccggtgcagggcttgcgagc
ctggccatcgggggaccgggcgttgccggcgtggaccagtcgctgctgttccaggtggtc
ctgccgctggtcctctccccgctggtggcctacagcggctccttcctcctggtgtacccg
gccacatgggtggcccgctacacccaggccaacgtggtgaaccagcggttccgccggggg
caggccgtagcggcgggggcggtggcgttcggccacggcctgcaggacggacagcgcgtc
agcgccgtcctgctgctggcactgctggcggccggctatgccgacggcgggatccccacc
tgggtggcggggctttgcgcggtgatgatgaccgccgggacccttttcggagggtggcgg
atctcgcacaccatcggctacaagatcacccggatcgatcccctgcgtggctccgtggca
cagacattcagcgcggtgatgctctttgtgggcgcgatcgggctgcactggcccctctcc
accacccacaccgtcacagccggcgccctgggtgcaggggagaaccagcatttttcggtc
accaaccggaagctggtcatccggatcctgtggctctgggggctgaccccgctggctacc
tgcgtcctcggcttcgtgcttgcgctggcactctcccccatctccacgtag

DBGET integrated database retrieval system