KEGG   Pseudarthrobacter sp. NIBRBAC000502771: NIBR502771_12980Help
Entry
NIBR502771_12980  CDS       T06121                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
psni  Pseudarthrobacter sp. NIBRBAC000502771
Pathway
psni00450  Selenocompound metabolism
psni00970  Aminoacyl-tRNA biosynthesis
psni01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psni00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    NIBR502771_12980
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    NIBR502771_12980
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:psni01007]
    NIBR502771_12980
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:psni03016]
    NIBR502771_12980
Enzymes [BR:psni01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     NIBR502771_12980
Amino acid related enzymes [BR:psni01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   NIBR502771_12980
Transfer RNA biogenesis [BR:psni03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    NIBR502771_12980
 Prokaryotic type
   Other AARSs
    NIBR502771_12980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: QDG63150
UniProt: A0A4Y6QS62
Position
2779028..2780587
Genome map
AA seq 519 aa AA seqDB search
MTAPEKTPFYITTAITYPNGVPHIGHAYEYIATDAMARFKRLDGYDVMFLTGTDEHGMKI
AQTAEKEGITPKELVDRNAEVYKAAHSDLGISYDRFIRTTDEDHYAASQAIWKKMEANGD
IYLDKYEGWYSVRDEAFYAEDETVVKDDGVRYSKETDTEVTWTAEESYFFRLSAYQDKLL
ALYESHPEFGAPQYRFNEVISFVKRGLEDLSISRTTFDWGVPVPGNDKHVMYVWVDALTN
YLTGVGYPDVDSEKFRKYWPADVHIIGKDISRFHAIYWPAFLMSAGLELPKRVMIHGFLH
NNGVKMSKSLGNVVAPADFVARYGLDQVRFFFLREVPFGADGSYNHEAIVGRMNADLANN
FGNLAQRSLSMVAKNCDAAVPTPGEFTAADQAILDQANGLLDAARAAFDKQEFSRALEAI
WGVLHHTNAYFAEQAPWVLRKTDVERMNTVLYVTLEVLRIVAILAQPVMPGASAKLLDAL
GQADGGSRQFAAIATPIVPGTALPAPAPVFPKFEEPAEA
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
gtgactgctccagagaaaacgccgttctacatcaccacggccatcacctaccccaacggc
gtaccgcacatcgggcacgcctacgagtacattgccaccgacgccatggcgcgcttcaag
cggctggacggctatgacgtgatgttcctgaccggcaccgacgagcacggcatgaaaatt
gcccagaccgcggagaaggaaggcatcacgcccaaggaactggtggaccggaacgcagag
gtctacaaggctgcgcattccgacctgggcatcagctacgaccgcttcatccgcaccacc
gacgaagaccactacgcggcctcgcaggccatctggaagaagatggaagccaacggcgac
atctacctcgacaagtacgagggctggtactccgtccgggacgaggccttctacgccgag
gatgagacggtggtgaaggacgacggcgtgcgctactcgaaagagacggacaccgaagtg
acgtggacggcggaggagagctacttcttccggctctccgcctaccaggacaagctgctg
gcactgtatgaatcccacccggagttcggtgcaccccagtaccggttcaacgaggtcatc
agcttcgtcaagcgcggcctggaggacctgtccatcagccgcaccacgttcgactggggc
gttcccgtgcccggcaacgacaagcacgtcatgtatgtctgggtggatgcgctgaccaac
tacctcaccggcgtcggctacccggatgtggactcggagaagttccggaagtactggccc
gccgacgtccacatcatcggcaaggacatctcccggttccacgccatctactggcccgcc
ttcctgatgagtgccgggctggaactgcccaagcgcgtgatgatccacggcttcctgcac
aacaacggggtcaagatgtccaagtccctgggcaacgtggtggcgccggcggacttcgtg
gcccgctacggcctggaccaggtgcggttcttcttcctgcgcgaggtcccgttcggcgcc
gacggcagctacaaccacgaggccatcgtgggccggatgaacgcggacctcgcgaacaac
ttcggcaacctggcccagcggtccctgtccatggtggcgaagaactgtgacgccgcggta
cccacccccggggagttcacggctgcagaccaggccatccttgaccaggccaacggcctg
ctggacgccgcccgcgccgccttcgacaagcaggagttcagccgggccctggaggccatc
tggggcgtgctgcaccacaccaacgcctacttcgccgagcaggcgccctgggtgctgcgg
aagaccgacgtcgagcgcatgaacaccgtgctctacgtgacgctggaggtcctgcggatc
gtggccatcctggcgcagccggtcatgcccggcgcatccgccaagctgctggacgcgctg
ggccaggccgacggcgggtccaggcagttcgcggcaatcgccacccccatcgtgcccggc
accgcactgcccgcccccgcccccgtcttcccgaagttcgaggaacctgccgaagcctga

DBGET integrated database retrieval system