KEGG   Pseudarthrobacter sp. NIBRBAC000502771: NIBR502771_14790Help
Entry
NIBR502771_14790  CDS       T06121                                 

Definition
(GenBank) methyltransferase domain-containing protein
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
psni  Pseudarthrobacter sp. NIBRBAC000502771
Brite
KEGG Orthology (KO) [BR:psni00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:psni03009]
    NIBR502771_14790
Enzymes [BR:psni01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     NIBR502771_14790
Ribosome biogenesis [BR:psni03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    NIBR502771_14790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_31 Ubie_methyltran Methyltransf_12 Methyltransf_23 LSDAT_prok DeoRC
Motif
Other DBs
NCBI-ProteinID: QDG63465
UniProt: A0A4Y6QTY0
Position
3160633..3161514
Genome map
AA seq 293 aa AA seqDB search
MPSADLPLLCPVCSRPLEYLPAEATHQPRLSCPEGHNFDVARQGYFNLLVGKGTPFEPDS
AAMVASRFAFLGNGHYAPLAHALASAVVPLLREEGAVVLDSGTGTGHYLREILDAAATAG
RPASAIGLDISKFALRRAARLNPEAVHLVWDIWRPLPVAENSVDAVTVVFAPRNPEEFAR
VLRPGGVLAVVTPRPGHLAGIAAVTGMLGIEEGKDERLADAMAGHFEPKTSLDVDIPLTL
GRAAAADLAFMGPAGHHLDRDQITARLESSAEPVRDDARFRISVFRPRAQGAP
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgccttccgcggaccttcccctcctgtgccccgtctgctcacgtccactggagtacctg
cctgcggaggccacgcaccagccacgcctgtcgtgcccggaggggcacaacttcgatgtc
gcccggcagggctacttcaacctgctggtgggtaagggcacaccctttgaacctgacagc
gccgcgatggtggcgtcacggttcgccttcctggggaacggccactacgcgccgctggca
cacgccctggcctccgccgtcgtacctttactgcgggaggaaggcgctgtggttctggac
tccggaaccgggaccggccattacctgcgggagatcctcgacgctgcagccaccgcgggc
cgcccggcctctgcaatcggactggacatctcgaagttcgccctccgccgggctgcccgc
ctcaacccggaggccgtccacctggtctgggacatctggcggccgcttccggtggcggag
aattcggtggatgcggtcaccgtggtcttcgctccgcggaaccccgaagagttcgcccgg
gtcctgcgcccagggggtgtgctggcagtggtgacgccgcggcccggacatttggcaggc
atcgcggccgtaaccggaatgctcggcattgaagagggcaaggacgagcgcctggcggac
gcaatggccgggcacttcgagcccaaaacatcccttgacgtggacataccgctcacgctg
ggccgcgcggccgcggcggacctggcgttcatgggaccggccggccaccacctcgaccgg
gaccagatcacggcccggctggaaagctccgcggaaccggttcgggacgacgcaaggttc
cggatttccgtgttccggccccgggcccagggcgccccgtaa

DBGET integrated database retrieval system