KEGG   Pseudarthrobacter sp. NIBRBAC000502771: NIBR502771_17690Help
Entry
NIBR502771_17690  CDS       T06121                                 

Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
psni  Pseudarthrobacter sp. NIBRBAC000502771
Pathway
psni00471  D-Glutamine and D-glutamate metabolism
psni00550  Peptidoglycan biosynthesis
psni01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psni00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    NIBR502771_17690
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NIBR502771_17690
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:psni01011]
    NIBR502771_17690
Enzymes [BR:psni01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     NIBR502771_17690
Peptidoglycan biosynthesis and degradation proteins [BR:psni01011]
 Precursor biosynthesis
  Amino acid ligase
   NIBR502771_17690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Oxidored_nitro Mur_ligase AlaDh_PNT_C 2-Hacid_dh_C FAD_binding_3 IlvN
Motif
Other DBs
NCBI-ProteinID: QDG63963
UniProt: A0A4Y6QTU1
Position
complement(3796971..3798533)
Genome map
AA seq 520 aa AA seqDB search
MTVSPRLANLVSWDSDWAGLRVAVTGIGVSGFAAADTLIELGARVVVVDAATSDTARAHA
DTLKIVGAADVLLGPDAVAHLPRIDGELPELIVTSPGWRPDQALLAAAARAHIPVWGDVE
LAWRVRVREGRKTADWLAITGTNGKTTTVGLTESMLRAAGLKAIAVGNVGTPILDALRDP
VEYDVFAVELSSFQLHWAESVSPVASVCLNVAEDHVDWHGSYDSYLADKAKVYERTQKAC
IYNAEQVETERMVENADVVEGCRAVAFTTLTPAISMLGVVEGLLVDRAFIEERRDSAAEL
ASMADLGPLAPRHMVANALAAAGLVRAYGVDAKAVRQGILDYVPGDHRIQPVARMNGVLW
VNDSKATNPHAASASLSAFSKVVWIAGGLSKGVSYDDLVRDHAARLKAVVLIGTDTSHLR
EALQRHAPDVPVIEPGAGDTEGVETASAPGGTPAGTPGNGEQVMAWAVASAARLAESGDT
VLMAPAAASMDQFSSYAHRGGTFIDAVRELVEGQAQTGEE
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
gtgactgtttccccgcgcttggcaaacctcgtttcctgggactctgactgggccggcctg
cgcgtcgccgtgacgggtatcggcgtgtccggatttgccgccgcggataccctaatcgag
ctcggtgcccgcgtggtggtggtggatgccgccaccagcgacacagcccgcgcacacgcc
gacaccctgaagatcgtgggtgccgccgatgtcctgctgggtccggacgcggtggcccac
ctgccgaggatcgatggcgaacttccggaactgatcgtgacctcgccgggctggcggccg
gaccaggcgctgcttgccgcagcggcacgggcgcacatcccggtctggggcgacgtcgaa
cttgcctggcgggtaagggtcagggaaggccggaagacggcggactggctggccatcacc
ggcaccaacggcaagaccaccactgtgggcctcacagaatcgatgctgcgggccgcgggc
ctgaaggccatcgccgtcggcaacgtgggcacccccatcctcgatgcccttcgtgaccct
gtggagtacgacgtcttcgccgtcgaactttccagcttccagctgcactgggctgaatcg
gtctcgccggtggccagcgtgtgcctcaacgtggccgaagaccacgtcgactggcacggc
tcctacgattcctacctggccgacaaggcaaaggtctacgagcgcacccagaaagcctgc
atctacaacgccgagcaggtggaaaccgagcgcatggtggaaaacgccgacgtggtggaa
ggctgccgcgccgttgccttcaccaccctgacgcccgccatcagcatgctcggtgtcgtc
gaggggctgctggtggaccgggcctttatcgaagaacgccgggacagcgcagcggagctt
gcctcgatggccgacctcggcccgctggccccccgacacatggtggccaacgcccttgca
gctgccggcctggtgcgcgcgtacggcgtggacgccaaggccgtccgccagggcatcctc
gactacgtgcccggcgaccaccgcatccagcccgtcgcccggatgaacggtgtcctgtgg
gtcaacgattccaaagcgaccaacccccatgccgcgtcggcgtccctgtcggccttcagc
aaggtggtctggatcgccggcggcctgtcgaagggcgtgagctacgacgacctggtccgt
gaccacgcagcacggctcaaggcggttgtcctgatcggcaccgacacctcgcaccttcgg
gaagccctgcagcgacacgcgccagatgtcccggtgatcgaaccgggggcaggtgacact
gaaggagtggagactgcttcggcgcccggtggcacccctgccggtacccccggcaacggc
gaacaggtaatggcctgggctgttgcttcagcggcccggctcgccgaatccggcgacacc
gtgctcatggctccggcagctgcttccatggatcagttctcttcctacgctcaccgtggt
ggtactttcatcgatgctgtccgcgagctggtggaagggcaggcccagaccggcgaggag
taa

DBGET integrated database retrieval system