KEGG   Psychrobacter sp. G: PSYCG_03750Help
Entry
PSYCG_03750       CDS       T02715                                 

Definition
(GenBank) phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
pso  Psychrobacter sp. G
Brite
KEGG Orthology (KO) [BR:pso00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    PSYCG_03750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Med5
Motif
Other DBs
NCBI-ProteinID: AGP48287
UniProt: S4YSV4
Position
810693..812300
Genome map
AA seq 535 aa AA seqDB search
MGISSSSTEPTKSVGSMRINLFFAILMIGMTAYFLWWGLDYTMHQQTTLFIVATAFGVFM
AFNIGGNDVANSFGTSVGAGTLTIPQALGIAAIFEVSGAVLAGGEVTDTIRSGIVDLDGL
SVTPNQFIYVMLSALIAAAFWLLFATKKGLPVSTTHAIIGGVVGSSIVLGITLGGTEMAL
STVNWGKIGTIAISWVLSPLLGGVLSYLLYGQIKKNIIEYNDKTETHIATLKDSKKTLKL
THKEYLDGLTESEQLSYTSAMLRDQEIYKDDDCVVEDLETNYYKELYEIENERSNLDTLK
ALKQWVPIIAAAGGAVMASLVIFKGLKNVNNGMTTLQGFLIMGMIAALVWLATYIYTKSI
RGKHKEDLTKATFIMFSWMQVFTASAFAFSHGSNDIANAVGPFAAIMDVIRTNSISTEAA
VPPAVMLTFGVALIVGLWFIGKEVIQTVGTNLAKMHPASGFSAELAAAAVVMGASTMGLP
VSSTHTLVGAVLGIGIVNRDTNWALMKPIGLAWIITLPAAASMSAISYIVLINIF
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgggtattagcagcagctctacagaaccaacaaaatcagtcggctctatgagaattaat
ctattttttgccattttaatgattggaatgaccgcctactttttgtggtggggtctagat
tacaccatgcaccagcagacgacgctatttattgtcgccactgcttttggtgtttttatg
gcattcaatatcggcggtaatgatgtcgccaactcttttggtacctcagtcggtgcaggg
accttaaccatcccgcaagcgctaggtatcgcggcgatatttgaagtatcaggcgccgtg
ctggcaggcggtgaagtgaccgatacgattcgaagcggcattgtcgatttagatggtctt
tcagtaacgcccaaccagttcatttatgtcatgctgtcagcgctcatcgctgctgcattt
tggctgttgtttgccaccaaaaaaggtctgccggtttcgaccacacacgcgattattggc
ggcgtagttggtagctcaattgtattgggtatcaccttaggtggtactgaaatggcattg
tcgacagtgaattggggcaagattggcacgatcgccatctcttgggttttgtcaccgcta
ctaggcggcgttttgtcttatctgttatatggacagattaagaaaaacatcatcgagtat
aatgataaaacagagacgcatattgctactctgaaagacagtaaaaagacgttaaagctg
acgcataaagagtacttggatggtttaaccgagtctgagcagttgtcttatacgtcagcg
atgttgcgtgaccaagaaatctataaagatgatgattgcgtcgttgaagatttagagacg
aactattacaaagaactttatgagattgaaaacgagcgcagcaaccttgataccttaaaa
gcactcaagcaatgggtgcctattattgcggctgcaggcggcgcagtcatggcctctttg
gtcatcttcaaaggtctgaaaaacgtcaataatggtatgacgacgttgcaaggcttttta
attatggggatgatcgcagcattagtatggcttgcgacctatatttatactaagagtatc
cgcggtaagcacaaagaagatttgaccaaagccacgtttattatgtttagctggatgcaa
gtctttactgcatcagcgtttgcctttagtcatggttctaacgatattgccaacgctgtt
ggtccatttgcagcgattatggatgttatccgcaccaatagtatttcaacagaagcagca
gtaccacctgctgtgatgttaacttttggtgtggcattgattgtcggtctttggttcatc
ggtaaagaagtgattcagactgtcggtaccaatttggcaaaaatgcatcctgcttctggt
ttctcagctgagttggctgcggctgcggttgtgatgggtgcgtcgacgatgggtctacca
gtatcgagtacgcataccttggtcggtgctgtacttggcattggtatcgtcaatagagat
accaactgggcactgatgaaaccaattggtttggcatggattattacccttcctgcagca
gcaagtatgtctgcaatcagttatatagtgctgataaatatcttttaa

DBGET integrated database retrieval system