KEGG   Psychrobacter sp. G: PSYCG_05585Help
Entry
PSYCG_05585       CDS       T02715                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pso  Psychrobacter sp. G
Pathway
pso00071  Fatty acid degradation
pso00072  Synthesis and degradation of ketone bodies
pso00280  Valine, leucine and isoleucine degradation
pso00310  Lysine degradation
pso00362  Benzoate degradation
pso00380  Tryptophan metabolism
pso00620  Pyruvate metabolism
pso00630  Glyoxylate and dicarboxylate metabolism
pso00640  Propanoate metabolism
pso00650  Butanoate metabolism
pso00900  Terpenoid backbone biosynthesis
pso01100  Metabolic pathways
pso01110  Biosynthesis of secondary metabolites
pso01120  Microbial metabolism in diverse environments
pso01130  Biosynthesis of antibiotics
pso01200  Carbon metabolism
pso01212  Fatty acid metabolism
pso02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSYCG_05585
   00630 Glyoxylate and dicarboxylate metabolism
    PSYCG_05585
   00640 Propanoate metabolism
    PSYCG_05585
   00650 Butanoate metabolism
    PSYCG_05585
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PSYCG_05585
   00072 Synthesis and degradation of ketone bodies
    PSYCG_05585
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSYCG_05585
   00310 Lysine degradation
    PSYCG_05585
   00380 Tryptophan metabolism
    PSYCG_05585
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PSYCG_05585
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSYCG_05585
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PSYCG_05585
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pso04147]
    PSYCG_05585
Enzymes [BR:pso01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PSYCG_05585
Exosome [BR:pso04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSYCG_05585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Macoilin
Motif
Other DBs
NCBI-ProteinID: AGP48642
UniProt: S4YTV6
Position
complement(1251203..1252819)
Genome map
AA seq 538 aa AA seqDB search
MSNKSNHPDSPVVETTVVKASDAKSTDTAVKSDITDAKKTDAKAAEPKADSAKKETVAKD
SKTTATKDDNAAKESTAKSNSDKKEASKKADATPAKKTNTVAKKASTTKLSSGQNRVAIL
GGNRIPFARSNGSYADVSNTDMLTAALDGLVERFNLQDEKIGEVVAGAVMKLSRDINLTR
EATLNTALNPHTPTYDISQACGTGLQATFASANKIALGIIDSAITGGVDTTSDAPIAVGD
GLRKVLIKLGAAKDNKQRLKALMGLNPKDLLDTPQNGEPRTGLSMGDHQAITTLEWNISR
EAQDELAFNSHQNLARAYDEGFFDDLITPYKGLTRDNNLRPDTTLEKLAKLKPVFGKKNA
KPTMTAANSTPLTDGASCILLGTDEWAAAHGLKPLAYIVHQETAAVDFIGKSGDTEGLLM
APAYAVPRMLERAGLTLQDFDFYEIHEAFASQVLSTLAAWEDEKFCEERLGLDAPLGSID
RSKLNVNGSSLAAGHPFAATGGRILATAAKLLDQKGSGRALISICAAGGQGVTCILEK
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacaaaagcaatcacccagatagtcctgttgttgagaccaccgtagtaaaagcc
agtgatgctaagagcaccgatactgctgtaaaatcagacatcactgatgctaaaaaaaca
gatgccaaagcagcagaaccaaaagctgatagcgctaaaaaagaaaccgtagcaaaagat
agtaaaaccactgctacgaaagatgataacgcagctaaagaaagtacggcaaaaagtaac
agtgataaaaaagaagcatctaaaaaggctgacgcgactcctgctaagaaaacaaatact
gtggctaaaaaagcaagtacgactaagcttagctcaggtcagaaccgtgtggctatccta
ggtggcaaccgtatcccatttgctcgctcaaacggctcatatgctgatgttagcaacacg
gatatgctcactgctgcgttagatggtttggtcgagcgttttaacttacaagatgaaaaa
atcggtgaagtcgttgctggtgcagttatgaaactgagccgcgatatcaacttgactcgt
gaagcgacattaaatactgcacttaacccacataccccaacgtatgatatctctcaagct
tgtggtactggcttgcaagcgacgtttgcttctgccaataaaatcgcgcttggtatcatc
gattcagctattactggcggtgttgatactacttctgatgcgcctatcgcagtcggtgat
ggcttacgtaaagtattgattaaattgggtgcagctaaagacaataaacaacgcctaaaa
gcattgatgggtctaaacccgaaagatttacttgatacgccgcaaaatggtgagccacgt
actggtttatctatgggcgaccatcaagcgatcactacgcttgaatggaacatcagccgt
gaagcgcaagatgagcttgccttcaatagtcatcaaaacctagcacgcgcttatgacgaa
ggtttctttgatgatttaattaccccatataaaggtctgacccgcgataacaacttgcgt
ccagataccactttagagaagctagctaagctcaagcctgtttttggtaagaagaatgct
aagccaaccatgactgcagctaactctaccccattgactgatggtgcatcttgtatccta
ttgggtactgatgagtgggcggcagcacatggtctaaaaccattggcttatatcgtccat
caagaaacagcggctgttgatttcatcggtaaatctggtgatacagaaggcttgctcatg
gcaccggcctatgccgtaccgcgtatgcttgagcgtgctggtttgacgctacaagatttc
gatttttatgaaatccatgaagcttttgcttcacaagtattatcaacgcttgctgcatgg
gaagacgagaagttctgtgaagagcgtctaggtcttgacgcgccactaggctctatcgat
cgtagtaagctaaacgtcaacggctcatcacttgctgcaggtcatccatttgctgcaacc
ggtggtcgtatcctagccactgctgccaaactattagatcaaaaaggctcaggtcgtgcg
cttatctctatttgcgccgctggcggtcaaggtgtgacctgtatcttagaaaaatag

DBGET integrated database retrieval system