KEGG   Psychrobacter sp. G: PSYCG_08140Help
Entry
PSYCG_08140       CDS       T02715                                 

Gene name
phhB
Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
pso  Psychrobacter sp. G
Pathway
pso00790  Folate biosynthesis
pso01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pso00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PSYCG_08140 (phhB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pso04147]
    PSYCG_08140 (phhB)
Enzymes [BR:pso01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     PSYCG_08140 (phhB)
Exosome [BR:pso04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSYCG_08140 (phhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a SANT_DAMP1_like Arteri_env
Motif
Other DBs
NCBI-ProteinID: AGP49142
UniProt: S4YV66
Position
complement(1887337..1887678)
Genome map
AA seq 113 aa AA seqDB search
MTTLSQASCEACRIGAPTVSDSEATELLQQIPEWTLIEIDGIKQLQRQYKFKNFVLAMAF
ANELAEISEAEGHHPGILVEWGKVTVTWWSHSIKGLHRNDFVMAAKTDSLLTK
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgacgacattatcacaagccagctgtgaagcctgccgtattggcgcaccgacagtcagc
gacagcgaagcaacagagttattacaacaaataccagagtggacgttgattgaaatcgat
ggcatcaagcaattacagcgtcaatataaatttaagaatttcgttttagcaatggcattt
gccaatgagcttgctgagatttctgaagcagaagggcatcatccgggcatattggtagag
tggggcaaggtgacggtcacttggtggtcgcacagtattaaaggtttgcatcgcaatgac
tttgtcatggcagccaagaccgacagcttactcaccaaataa

DBGET integrated database retrieval system