KEGG   Psychrobacter sp. G: PSYCG_08350Help
Entry
PSYCG_08350       CDS       T02715                                 

Gene name
metG
Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pso  Psychrobacter sp. G
Pathway
pso00450  Selenocompound metabolism
pso00970  Aminoacyl-tRNA biosynthesis
pso01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pso00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    PSYCG_08350 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PSYCG_08350 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pso01007]
    PSYCG_08350 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pso03016]
    PSYCG_08350 (metG)
Enzymes [BR:pso01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     PSYCG_08350 (metG)
Amino acid related enzymes [BR:pso01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   PSYCG_08350 (metG)
Transfer RNA biogenesis [BR:pso03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    PSYCG_08350 (metG)
 Prokaryotic type
   Other AARSs
    PSYCG_08350 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1 T4_baseplate DUF4413
Motif
Other DBs
NCBI-ProteinID: AGP49183
UniProt: S4Z3U8
Position
1934279..1936381
Genome map
AA seq 700 aa AA seqDB search
MKVREILVTSALPYANGDIHLGHLVEYIQTDIWVRSMKAQGHKVTYVCADDAHGTAIMLK
AEDNGVTPEQQIANVQAAHEADFAKFLINFDNYHSTHSEENREFSELIYRRLRDAGHIST
RDVEQLFDPEKQLFLADRFVKGTCPECAATDQYGDNCEVCGTTYDATELKDPYSTLSNAM
PILKTSKHYFFDLPEFEQFLKDWTRSDNRLQTSVANKLQEWFDAGLTSWDISRDAPYFGF
QIPDTPSDEPDKYFYVWLDAPVGYMASFQNLCDKRAGTEEALDFDHYWAQENEHKTEVYH
FIGKDIVYFHALFWPAMLAGSELRTPTGVFAHGFLMVNGEKMSKSRGTFIKADTYAEHLH
PEYLRYYFASKLSDKVEDINLDLEDFMQKVNSDLVGKVVNIASRSAGFLVKKYDGMLTDV
CAEPSLLEDITKTGDEIAAAYENREFSRAMRLIMQCADKANEYIDDKKPWALAKVEGAEQ
EVQDVCSVAINIFRQLMVYLAPVLPELTANAKEFLNIDDLSFASRNEWLLGHQINKFKPL
MQRIEEKDIAAMVEDSKASLTQVGAPTASQDDKAAAKNTSPAAMPSSTEQADYIGIEDFA
KVEMKVAHVIACNHVEGADKLLQFTLDVGEAQPRNVFSGIRKFYEPEQLQGKKVICVTNL
APRKMKFGISEGMVLSSGDPKTGLVVITLPDEAVIGDSLA
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgcgtgagattttagtaaccagtgccctgccctacgccaatggagacattcac
ttggggcatcttgtagagtatatccaaactgatatttgggtacgatcgatgaaggcgcaa
ggccataaggtgacttatgtctgtgcggatgatgctcatggtactgctatcatgctcaaa
gccgaagacaatggcgtaacaccagaacagcaaattgccaatgtgcaagctgctcatgaa
gccgattttgctaagtttttgattaattttgacaattatcattcaacgcattcagaagaa
aatcgggaattttctgagctgatttatcgccgccttagagatgcaggtcatatctctact
cgtgatgtggagcagctatttgaccctgaaaaacagctgtttttagccgatcgttttgtt
aaaggtacctgccctgagtgcgccgctaccgaccaatatggtgataattgtgaagtttgt
ggtacgacttatgatgcgacagaacttaaagatccgtactctacgttatcaaatgcgatg
cctattctaaagacttcaaagcattatttctttgatttaccagagtttgagcaattttta
aaggattggacgcgcagtgataatcgcttgcaaacctcagttgccaataagctacaagag
tggttcgatgccggcttaaccagttgggatatctcgcgtgatgcgccttactttggcttt
caaattccagacacgccaagcgatgagccagataaatacttctatgtatggctagatgcg
cctgttggctatatggcaagctttcagaacttgtgtgataaacgtgcaggtacagaagag
gctctagactttgaccattattgggcgcaagaaaacgagcataaaaccgaagtgtatcac
ttcatcggtaaagatattgtttacttccatgcgctattttggcctgccatgcttgctggt
agtgaactccgtacaccaaccggcgtctttgctcatggcttcttgatggtcaatggcgaa
aaaatgagtaagtcgcgtggcacctttattaaagccgacacttatgctgagcatttgcat
cctgagtacttgcgttattactttgcgagtaagttatctgacaaagtcgaggacattaac
cttgatttagaagactttatgcaaaaggttaactctgatctcgttggtaaagtagtcaat
atcgccagtcgcagcgctggatttttggtcaaaaagtatgatggtatgctgacagacgtc
tgtgctgagccaagcctattagaagacatcaccaagacgggcgatgaaattgctgcggct
tatgaaaaccgtgaattttctcgtgccatgcgcctgattatgcagtgtgctgataaagcc
aatgaatacatcgatgacaaaaaaccgtgggcgcttgccaaggttgaaggcgcagagcaa
gaagttcaagacgtctgctcagtagcaatcaatatcttccgtcaattaatggtatatctt
gcgcctgtattacctgagctgactgccaatgctaaagaattcttgaacattgatgattta
agttttgccagccgtaatgagtggttgcttggtcatcaaattaataagtttaaaccactg
atgcagcgtattgaagaaaaagatattgcagcgatggttgaagattctaaagcctcattg
acacaagtaggtgcgcctaccgctagccaagacgataaagcagcagcaaaaaatacctcg
cctgcagcaatgccaagcagtaccgaacaagcagactatatcggtatcgaggactttgcc
aaagtcgagatgaaagtcgctcatgttatcgcttgcaaccatgtcgaaggcgcggacaaa
ctgcttcagttcacactagatgttggtgaagcacaacctcgcaacgtctttagtggtatt
cgcaaattctatgagcctgagcaattacaaggtaaaaaggttatttgcgtgaccaatttg
gcaccgcgtaagatgaaatttggcatatcagaaggcatggtattgtcgtcaggcgacccg
aaaacaggtctggtggtaattaccttacctgatgaagccgttatcggtgattcactggct
taa

DBGET integrated database retrieval system