KEGG   Phytophthora sojae: PHYSODRAFT_250104Help
Entry
PHYSODRAFT_250104 CDS       T03459                                 

Definition
(RefSeq) hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
psoj  Phytophthora sojae
Pathway
psoj00450  Selenocompound metabolism
psoj00970  Aminoacyl-tRNA biosynthesis
psoj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psoj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    PHYSODRAFT_250104
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PHYSODRAFT_250104
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:psoj01007]
    PHYSODRAFT_250104
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:psoj03016]
    PHYSODRAFT_250104
Enzymes [BR:psoj01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     PHYSODRAFT_250104
Amino acid related enzymes [BR:psoj01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   PHYSODRAFT_250104
Transfer RNA biogenesis [BR:psoj03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    PHYSODRAFT_250104
 Prokaryotic type
   Other AARSs
    PHYSODRAFT_250104
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-GeneID: 20638001
NCBI-ProteinID: XP_009537358
JGI: Physo3_250104
UniProt: G5AB13
Position
Unknown
AA seq 714 aa AA seqDB search
MSTTADLAARVDKLEVAQQQQDARVEALESKVAAAKPARETFYLTTAIHYTNGLPHMGHA
YENVCSDVISRYHRVFGRDVYFLTGTDEHGQKIAQTAEAAGVTPQQLVDKYAGIFQQLTK
DLNMSNNNFIRTTSDVHKKFAQWLFQRALDKGDVYLGKYEGWYNVREETFVTETEAQLTN
YKDPTTGTPFKKMQEESYFFKMSKYQDRLVKHIEENPEFLQPEVRRQELLRRLKEPLQDL
SASRNTFTHGIPLLNDPKHVLYVWFDALANYLSAIGYPDGENSRYWPANVHIIGKDITWF
HCVIWPCILMSTEIPLPKRVFAHGFVNAKDGSKMSKSVGNVVDPYEMIGKYGIESFRYFI
VRSAKFGQDMPFSEDDLINIHNSELADTLGNLVHRTVNICKKYSNGVVPDVKADKPFDIY
ELLKESEDSYKDFALQNACLAIVNALKETNKYLTDKAPWHIKESEPRLVVVRTCLEAIYV
LAHYLSAIIPETAKIIFQKLGTAPTTLTALSPEYDNLKPGTEVSIGDILFNKVLTEEEKQ
KQSEAAAAKAKPAKAKPEKVATPLFASLDIRVGVISKVWKHPESEKLYCEEIDIGEEEPK
QIASGLQPFYSLEEMQNRKVLVLLNLKPAKLGGFKSHGMVLCACDEAHENVQFVEPPADA
KVGERVTVKKQKVLEKVSPDFLTDDKCVATYKGEPIMTSAGPCTAKSLVKAFIS
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgaccgcggacctcgccgcccgcgtggacaagctggaggtggcgcagcagcag
caggacgcgcgcgtggaggcgctggagtcgaaggtggcggccgccaagcccgcgcgcgag
accttctacctcacgacggccatccactacacgaacggcctgccgcacatgggccacgcc
tacgagaacgtgtgctcggacgtcatcagccgctaccaccgcgtgttcggccgcgacgtg
tacttcctcacgggcacggacgagcacggccagaagatcgcgcagacggccgaggccgcg
ggcgtcacgccccagcagctcgtggacaagtacgccggcatcttccagcagctcaccaag
gatctcaacatgagcaacaacaacttcatccgcaccacgagcgacgtgcacaagaagttc
gcccagtggctcttccagcgcgcgctggacaagggcgacgtctacctcggcaagtacgag
ggatggtacaacgtgcgcgaggagaccttcgtcacggagacggaggcccagctcacgaac
tacaaggaccccaccacgggcacgcccttcaagaagatgcaggaggagtcgtacttcttc
aagatgtccaagtaccaggaccgcctggtcaagcacatcgaggagaaccccgagttcctg
cagcccgaggtgcgtcgccaggagctgctgcgtcgcctcaaggagccgctgcaggatctg
tcggcctcgcgcaacaccttcacgcacggcatcccgctgctcaacgaccccaagcacgtg
ctgtacgtctggttcgacgcgctggccaactacctgtcggccatcggctacccggacggc
gagaactcgcgctactggcccgccaacgtgcacatcatcggcaaggacatcacgtggttc
cactgcgtcatctggccctgcatcctgatgagcacggagatcccgctgcccaagcgcgtg
ttcgcgcacggcttcgtgaacgccaaggacggctccaagatgagcaagagcgtgggcaac
gtcgttgacccgtacgagatgattggcaagtacggtatcgaatcgttccgctatttcatc
gtgcgctcggccaagttcggccaggacatgcccttctccgaggacgacctcatcaacatc
cacaactcggagctggcggacaccctgggcaaccttgtgcaccgcactgtcaacatctgt
aagaagtactcgaacggtgttgtgcccgacgtcaaggcggacaagccgttcgacatctac
gagctgctcaaggagtcggaggactcgtacaaggactttgccctgcagaacgcctgcctg
gccatcgtcaacgcgctcaaggaaaccaacaagtacctgacggacaaggctccgtggcac
atcaaagagagcgagccgcgccttgtggttgtgcgcacctgtctggaggccatctacgtg
ctggctcactacctgagcgccatcatccccgagacggccaagatcattttccagaagctc
ggcacggccccgacgacgctgacggcgctgtccccggagtacgacaatctgaagccaggc
actgaggtgtcgatcggcgacatcctgttcaacaaggtcctgaccgaggaggagaagcag
aagcagagtgaggcggccgctgccaaggccaagcccgcgaaggccaagcctgagaaggtc
gcgacgccgctcttcgcctcgctggacatccgcgtcggcgtgatctccaaggtgtggaag
cacccggagtcggagaagctgtactgcgaggagattgacatcggtgaggaggagcccaag
cagattgcctcgggcctgcagccgttctactcgctggaggagatgcagaaccgcaaggtg
ctggtgctgctgaacctcaagccggccaagctgggcggcttcaagtcgcacggcatggtg
ctgtgcgcgtgcgacgaggcccacgagaacgtgcagttcgtggagccccccgccgacgcc
aaggtgggcgagcgcgtgacggtcaagaagcagaaggtgctggagaaggtctcgccggac
ttcctcaccgacgacaagtgcgtggcgacgtacaagggcgagccgatcatgacatccgcc
ggcccgtgcaccgccaagtcgctggtgaaggcgtttattagctag

DBGET integrated database retrieval system