KEGG   Phytophthora sojae: PHYSODRAFT_251811Help
Entry
PHYSODRAFT_251811 CDS       T03459                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
psoj  Phytophthora sojae
Pathway
psoj00052  Galactose metabolism
psoj00500  Starch and sucrose metabolism
psoj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psoj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    PHYSODRAFT_251811
   00500 Starch and sucrose metabolism
    PHYSODRAFT_251811
Enzymes [BR:psoj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     PHYSODRAFT_251811
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C BNR_2
Motif
Other DBs
NCBI-GeneID: 20638195
NCBI-ProteinID: XP_009537800
JGI: Physo3_251811
UniProt: G5ACG2
Position
Unknown
AA seq 620 aa AA seqDB search
MKVIPSVIALGAFVTALVYSPQTARAQDVVEAEPGTELFNQFRPVYHFTPREKWMNDPCA
PYYDEATGLYHMFYQLNPNSTIWGNMTWGHAVSKDQVTWEDYPDALRPFEDKWDNLGVFS
GFAMDNAIEGKHTVFYTGVTALPISWKKPYLFGEHVVYATTEDGGKTWQKGSEPLIELPP
EGLNVTGWRDPMPFHSKSLDAHFGYDAANASNYLLVAGGIKEVGPRHFLYHSVDYKNWEY
KGYLIAQEKNTTFSQYSGSWGFNFETSIYREMTDEDGEMHNVMLFAAEGDPNRYPMWATG
TISGGGCGVETDAEAGLFTPLMVGVSDRSDWYANSIYTDKDGKNVLIGWITEDNNFTTGQ
PQGWDGMLSVPREVGITILRDINDVDSHLVGKGDWIVSDSKDVSCADGLAKQSKTIKTLS
VKALSDLQLLRNENAHEQVASVSMKGSSQVLNSTGASFELIAEVSEFERGSKVGFEVRRS
SAGDEVTTIVYDDAEKKIIIDRSKSSTATCAVFADNDVKPISESVWGHFYLYDIFTGASK
SDVCESKREKLSFHVFVDVSSVEVFVNDRFSLSARIYPCASQTKSDGIALTASGDATFEN
VQVWTEPKHAWADKRTVPSF
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgatcccgagcgtcattgccctcggggccttcgtgaccgccctcgtctacagc
ccgcagactgcgcgtgctcaagacgtcgtggaggccgagcctggcactgagctcttcaac
cagttccgccccgtgtatcacttcacgcctcgcgagaagtggatgaacgacccgtgcgcg
ccgtactacgacgaggccaccggtctgtatcacatgttctaccagctcaacccgaactcg
acgatctggggcaacatgacctggggccacgccgtgtccaaggaccaggtcacgtgggag
gactacccggacgcgctccgtccgtttgaggacaagtgggacaacctcggtgtgttctca
ggtttcgccatggacaacgccatcgaaggcaagcacacggtgttctacactggtgtgact
gccctccccatttcgtggaagaagccctacctgttcggcgagcacgtcgtgtacgctact
acggaagacggaggtaagacctggcagaagggcagcgagcctctgattgagctgccgcct
gagggcctcaacgtcacgggctggcgtgacccgatgccgttccactcgaagtcgctcgac
gctcactttggctacgacgctgccaacgcctctaactacctgctcgtggccggtggcatt
aaggaggttggcccccgccacttcctctaccactcggtggactacaagaactgggagtac
aagggctacctcatcgctcaggagaagaacaccacgttctcgcagtacagcggcagctgg
ggcttcaacttcgagacctccatctaccgcgagatgacggacgaggacggagagatgcac
aacgtgatgctgttcgctgctgagggcgacccgaaccgctacccgatgtgggccaccggc
acgatctccggcggtggctgcggtgttgagaccgacgctgaggcgggtctgttcacccct
ctgatggtcggagtgtcggaccgcagcgactggtacgccaacagcatctacaccgacaag
gacggcaagaatgtcctgatcggctggatcaccgaggacaacaacttcactactggtcag
ccgcagggctgggacggtatgctgtcggtgccgcgtgaggtcggtatcactatcctgcgc
gacatcaacgatgtcgacagccacctcgtgggcaagggcgactggatcgtgtccgactcc
aaggacgtgtcgtgcgccgacggcttggccaagcagagcaagaccatcaagacgctgagt
gtgaaggcgctgagcgacttgcagctgctgcgcaacgagaacgcgcacgagcaggtggcc
agcgtgtcgatgaagggctcgtcgcaggtgctcaactcgaccggtgcgtcgttcgagctg
atcgccgaggtgtcggagttcgagcgtggcagcaaggtcggtttcgaggtgcgtcgcagc
agcgccggtgatgaggtcacgaccatcgtgtacgacgacgcggagaagaagatcatcatt
gaccgctcgaagagttcgacggccacgtgcgccgtgttcgccgacaacgacgtgaagccg
atctcggagtcggtctggggccacttctacctgtacgacatcttcacgggtgcgtccaag
agcgacgtgtgcgagtcgaagcgcgagaagctgagcttccacgtgttcgtggacgtgtcg
agcgtcgaggtgttcgtgaacgaccgcttctcgctgtcggcccgcatctacccgtgcgcg
agccagaccaagtcggacggcattgctctgaccgcttcgggcgacgcgacgttcgagaac
gtgcaggtgtggacggagcccaagcacgcctgggctgacaagcgcaccgtgcccagcttc
taa

DBGET integrated database retrieval system