KEGG   Phytophthora sojae: PHYSODRAFT_317690Help
Entry
PHYSODRAFT_317690 CDS       T03459                                 

Definition
(RefSeq) hypothetical protein
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
psoj  Phytophthora sojae
Pathway
psoj00910  Nitrogen metabolism
psoj01100  Metabolic pathways
Module
psoj_M00531  Assimilatory nitrate reduction, nitrate => ammonia
psoj_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:psoj00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    PHYSODRAFT_317690
Enzymes [BR:psoj01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     PHYSODRAFT_317690
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Rieske_2 Pyr_redox Fer2_BFD NIR_SIR Rubredoxin_C NIR_SIR_ferr Pyr_redox_3 Rieske AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 20644110
NCBI-ProteinID: XP_009533168
JGI: Physo3_317690
UniProt: G4ZZY1
Position
Unknown
AA seq 1057 aa AA seqDB search
MADAVPTKKEVVVVVGNGMVGHRFLERLRKYDTSKRYALVSIGEEPIQHYNRMLLTEYFE
HLSIDKLKLAPPNWYAENEVDLLTNAQVLAIDTANKKVLCQRLGDENASKGELQFEVPYN
RVVIATGASALVPRLPGTSLRGVFVYRSIADLNNIIAHGEQQAKLEAAGGPKKYALVVGG
GLLGLEAAKAVHDLKVAVRVINRGTQLMSRQLDADGAKVLHNEIVNKFGIDVLYDKSTQE
ILGSEENGVEAVQFTNGERFDDVCMIIFATGIKPRDELAHSSGLELAKRGGILINDYLEC
SAPSVYALGECISHRNFTYGLVAPGYEMADTLAKNFTCRSPEDRIAFPGGDVSTKLKLMG
MEVGSFGDYFPEFIKEPFEALTYNNPLEKVYKKLFFSADGKKLLGGILVGDTSDFVRLSL
MYKQKDTKPLEDPPNEILLGKRGGGDGNSVLDLPDEAQVCSCNNVSKGDICKAIKEKKLT
KLGDVKKVCNVGTGCGGCIPMVKDILEAELAAAGTAVDKSLCEHFAYSRQELYQIIQVEQ
YSTFAEVLAKHGRKQHDPRSYGCEICKPTVASILASLQNGHILKGDRAPLQDSNDRFLAN
LQKSGQFSVVPRVAGGEITPDKLIVLGQVAKKFDLYTKITGGQRVDLFGAQKQGLPEIWR
MLVEAGFESGHAYGKSLRTVKSCVGTTWCRYGQQDSVGFAIFLENRYRGIRSPHKLKGGV
SGCTRECAEARGKDFGCIATDTGYNVYVGGNGGTNPRHATLLASDVPQDLAVKYLDRYIM
YYIMTADRLQRTSKWLDTLEGGIEQLRRVVMQDSLGICATLEKQMSYLVGTYECEWKKVI
ESPELMAQFAQFKNTSETQKEVQMHTVRDQRMPTTFVAKAKSGSSSPTGIESSSPASSSS
ILADLDDTEWVSFGSKDLFDANGGGAVLYGESQLAIFNIVESCNGIEKVSWFATQNMCPF
DHSFVLAQGIVGDLDGRPKVACPMHKRNYDLADGCCLSGDDLRLQTFEAKEEDGTIYVLL
PPTDVVDARLATSKFVAQEGGSPAPPEVAAAPVTLDW
NT seq 3174 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgctgttcctaccaagaaggaggtggtcgtggtcgtgggcaacggcatggtg
ggccaccgcttcctggagcgactgcgcaagtacgacacgagcaagcgctacgccctcgtc
tctatcggggaggagcccatccagcactacaaccgcatgctgctgaccgagtacttcgag
catctgagcatcgacaagctcaagctggccccgcccaactggtacgccgagaacgaggtc
gacctgctcaccaacgctcaagtgcttgccatcgacacggcaaacaagaaggtgctgtgt
caacgcctcggcgacgagaacgcatcgaagggagagctacagtttgaagtgccctacaac
cgcgtagtgatcgctacgggcgccagcgcactggtgccccgactccccggcaccagcttg
cggggcgtgtttgtgtaccgctcgatcgctgacctcaacaacatcattgcgcacggcgag
cagcaagccaaactcgaagctgctggcggtcccaagaagtacgcgctggtggtcggtggc
gggctgctgggtctcgaggccgctaaggccgtccacgatctgaaggtggccgtacgggtc
atcaaccggggcactcagctcatgtcacgccaactcgacgctgatggcgcaaaggttctc
cacaacgagatcgtgaacaagttcggcatcgacgtactctacgacaagtccacgcaagag
atcctcgggagcgaggagaacggcgtcgaggcagtgcagttcaccaacggcgagaggttt
gatgatgtgtgtatgatcattttcgcgacgggaatcaagccgcgcgacgagctcgcgcac
tccagcggcctggaactggctaagcgagggggcatcctcatcaacgactacttggagtgc
agtgcgccgagtgtgtacgcgcttggagagtgcatctcacaccgcaacttcacgtacggc
cttgttgcccccggctacgagatggccgacactctggccaagaacttcacgtgcagatcc
ccggaggaccgtatcgcattccccggtggtgacgtctccaccaagctgaagctcatgggg
atggaggtcggctcgttcggtgactactttcccgagtttatcaaggagccgttcgaggcc
ctcacatacaacaacccgctggagaaggtgtacaaaaagctcttcttttcagctgacggt
aagaagctgctcgggggcatccttgttggcgacacaagcgacttcgtgcgtctctcactc
atgtacaagcagaaagacacaaagccgctcgaggacccgccgaacgagatcctgctcgga
aagcgtggtggaggggacggtaactcggtgcttgatctcccggacgaagctcaagtttgc
tcgtgcaacaacgtgagcaagggagacatctgcaaggccatcaaggagaagaagctgacc
aaacttggcgacgtgaagaaggtctgcaacgtcgggaccggctgcggcggctgcatcccc
atggtgaaggatatcttggaggctgaacttgcagctgctggcactgccgtcgacaagtct
ctctgtgaacacttcgcctactcacgtcaggaactctaccagatcattcaggtcgagcaa
tactccactttcgccgaggtgttggccaagcatggccgcaagcagcacgatcctcgaagc
tacggctgcgagatctgcaagcccacggtggcttccattctcgcgagtcttcagaatggc
cacatcctcaaaggggaccgtgctccgctgcaggattcgaacgaccgcttcttggcgaac
ttgcagaagtcgggacaattctccgtcgtcccgcgcgtcgctggtggagagatcacacca
gacaagctcatcgtgctggggcaagtcgccaagaagttcgatctgtacacgaaaatcacc
ggcggacagcgcgtggacctcttcggtgcgcagaagcagggtctcccggagatctggcgg
atgctggtggaggccggcttcgagtcgggccacgcgtacggcaagtccctacgcacagtc
aagagctgcgtcggtacgacgtggtgccgctatggccagcaggactcggtcggcttcgcg
atcttcctcgagaaccggtaccgcggcatccgctcgcctcacaaactcaagggaggcgtc
tccggctgcacccgcgagtgtgcagaggctcggggcaaggacttcggctgcatcgccacg
gacacgggctacaatgtgtacgtgggcggcaatggcggcaccaaccctcgtcatgccacg
ctccttgcttcagatgtcccgcaggacctggccgtcaagtacttggatcgctacatcatg
tactacatcatgactgctgaccgcctgcaacgcacgtccaagtggctggacactcttgag
ggcggcattgagcagctccggcgtgttgtgatgcaggactcgctggggatctgcgcgacg
ctggagaagcagatgagctacctcgtgggcacgtacgagtgcgagtggaagaaggtgatc
gagtcgcccgagctgatggcgcagttcgcccagttcaagaacaccagcgagacccagaag
gaggtgcaaatgcacacggtgcgcgaccagcggatgcccacgaccttcgtagccaaggcc
aaaagcggcagcagcagccccacgggcatcgagtcctcgtctcccgcgtcttcgtcctcc
atactggccgatctggacgacacggagtgggtctcgttcggcagcaaggacctcttcgac
gcgaacggcggcggcgccgtgctctacggcgagtcgcagctggccatcttcaacatcgtc
gagagctgcaacggcatcgagaaggtctcgtggttcgccacgcagaatatgtgccccttt
gaccactcgttcgtgctggcgcagggcatcgtgggggacctggacggccggcccaaggtg
gcctgccccatgcacaagcgcaactacgacctggccgacggctgctgcctcagcggcgac
gacctgcggctgcagaccttcgaggccaaggaggaagacggcaccatctacgtgctgctg
cctcccacggacgtggtggatgcccgcctggcgacctccaagttcgtcgcgcaggaaggg
ggcagccctgcacccccagaggtggcggcagctcccgtcacgctggactggtaa

DBGET integrated database retrieval system