KEGG   Phytophthora sojae: PHYSODRAFT_319617Help
Entry
PHYSODRAFT_319617 CDS       T03459                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
psoj  Phytophthora sojae
Pathway
psoj00052  Galactose metabolism
psoj00500  Starch and sucrose metabolism
psoj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psoj00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PHYSODRAFT_319617
   00500 Starch and sucrose metabolism
    PHYSODRAFT_319617
Enzymes [BR:psoj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     PHYSODRAFT_319617
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF4975
Motif
Other DBs
NCBI-GeneID: 20644347
NCBI-ProteinID: XP_009537799
JGI: Physo3_319617
UniProt: G5ACG1
Position
Unknown
AA seq 604 aa AA seqDB search
MKVIPSVMALGTFVTALVFSPEAARADVEEAEPGTELFNQFRPVYHFLAREKWMSDPCAP
YYNEATGLYHMFYQSNPNSTIWGNMTWGHAVSKDQVTWKDYSDALLPFQDKWDNLGVFSG
FSMDNAIDGKHTVFYTGVTALPISWKNEYLFGEHVLYATTSNGGSTWQKGAKALIKLPPK
GMNVTGWRDPMSFHSHNYMLLAGGIHEEGPRIFLYHAEDYVNWEYKGFLLAPEKNTSFSE
YSANWGFNFETTIYREMKDEDGEMHNVMLFAAEGDPNRCPMWATGTFGAADSDSASADSD
AGLFTPLMHGKDVLIGWITEDNNFAKGQPQGWDGILSLPREVGISFVRDIHDVDDHLVGK
GDWILSSTQNVTVAGGKTLPSKTIKTLKVRPPSDLRLLRNTESGEVVPSVTLNGTSKALK
STGKSFELIAQVSDFERGTQVGFEVRPSKDAKKTTTILYDDKDKKIIIDRSSSSNAECPV
FVDNEVTPVSDDIWGHFYLYDVFQPADDSESGEGDVYKVTRENLNFHVFVDVSTVEVFVN
DRFALSARIYPCGEASDGISLTASGDATFEKVQVWTNPKHAWSAKRSVPTKQIHKKTGKV
VKTA
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgatcccgagtgtcatggccctcggcaccttcgtcaccgccctcgtcttcagc
cccgaggctgcccgcgctgacgtcgaggaggccgagcccggcactgagctcttcaaccag
ttccgcccggtttaccacttcttggctcgcgagaagtggatgagcgacccgtgcgcaccg
tactacaacgaggccaccggtctgtatcacatgttctaccagtccaacccgaactcgacg
atctggggcaacatgacctggggccacgccgtgtccaaggaccaagtgacctggaaggac
tactcggatgccctgctaccgttccaggacaagtgggacaacctcggtgtgttctcgggt
ttctccatggacaacgctatcgatggcaagcacacggtgttttacactggtgtcaccgct
ctccccatttcgtggaagaacgagtacctctttggtgagcacgtgctgtacgccaccacc
agcaacggcggctctacctggcagaagggtgccaaggccctcatcaagctgccgcccaag
ggcatgaacgtcacgggctggcgcgaccccatgtcgttccactcgcacaactacatgctc
ttggccggtggcatccacgaggagggcccgcgtatcttcctctaccacgctgaggactac
gtgaactgggagtacaagggcttcctgctcgctccggagaagaacacgtccttctccgag
tacagcgccaactggggcttcaacttcgagacgaccatctaccgtgagatgaaggatgag
gacggtgagatgcacaacgtgatgctcttcgccgctgagggcgacccgaaccgctgcccg
atgtgggccaccggcaccttcggtgctgccgacagtgacagcgcgagcgcggactcggac
gccggtctcttcacccctctgatgcacggcaaggacgtcctgatcggttggatcaccgag
gacaacaacttcgccaagggccagccccagggctgggacggcatcctgtcgctgccgcgt
gaggtcggcatctcctttgtgcgtgacatccacgacgttgacgaccacctggtcggcaag
ggcgactggatcctgtcgagcacgcagaacgtaacggtggccggcggcaagacgctgccg
agcaagacaatcaagacgctcaaggtgcgcccgcccagcgacctgcgtcttctgcgcaac
accgagtcgggcgaggtggtgcccagcgtgacgctgaacggcacgtccaaggcgctcaag
tcgaccggcaagtcgttcgaactcatcgcgcaggtgtccgacttcgagcgcggcacccag
gtgggcttcgaggtgcgccccagcaaggacgccaaaaagacgacgaccatcctgtacgac
gacaaggacaagaagatcatcatcgaccgctccagcagctccaacgccgagtgccccgtg
ttcgtagacaacgaggtgacccccgtctcggacgacatctggggccacttctacctgtac
gacgtcttccagcccgcggacgactcggagtctggagagggcgatgtgtacaaggtgacg
cgtgagaacctcaacttccacgtgttcgtggatgtgtcgacggtcgaggtgttcgtgaac
gaccgcttcgctctctcggcccgcatctacccgtgcggtgaggcgtcggacggcatctcg
ctcactgcgtcgggcgacgccactttcgagaaggtgcaggtgtggacgaacccgaagcac
gcgtggtcggccaagcgctcggtgcctaccaagcagatccacaagaagactggaaaggtc
gtgaaaacggcataa

DBGET integrated database retrieval system