KEGG   Phytophthora sojae: PHYSODRAFT_321565Help
Entry
PHYSODRAFT_321565 CDS       T03459                                 

Definition
(RefSeq) hypothetical protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
psoj  Phytophthora sojae
Pathway
psoj03040  Spliceosome
psoj04141  Protein processing in endoplasmic reticulum
psoj04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:psoj00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    PHYSODRAFT_321565
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    PHYSODRAFT_321565
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    PHYSODRAFT_321565
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:psoj01009]
    PHYSODRAFT_321565
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:psoj03041]
    PHYSODRAFT_321565
   03009 Ribosome biogenesis [BR:psoj03009]
    PHYSODRAFT_321565
   03110 Chaperones and folding catalysts [BR:psoj03110]
    PHYSODRAFT_321565
   04131 Membrane trafficking [BR:psoj04131]
    PHYSODRAFT_321565
   03051 Proteasome [BR:psoj03051]
    PHYSODRAFT_321565
   03029 Mitochondrial biogenesis [BR:psoj03029]
    PHYSODRAFT_321565
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psoj04147]
    PHYSODRAFT_321565
Protein phosphatases and associated proteins [BR:psoj01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     PHYSODRAFT_321565
Spliceosome [BR:psoj03041]
 Complex B
  Other components
   Prp19 complex
    PHYSODRAFT_321565
 Complex C
   Prp19-CDC5 complex
    PHYSODRAFT_321565
Ribosome biogenesis [BR:psoj03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    PHYSODRAFT_321565
Chaperones and folding catalysts [BR:psoj03110]
 Heat shock proteins
  HSP70 / DNAK
   PHYSODRAFT_321565
Membrane trafficking [BR:psoj04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    PHYSODRAFT_321565
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    PHYSODRAFT_321565
Proteasome [BR:psoj03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    PHYSODRAFT_321565
Mitochondrial biogenesis [BR:psoj03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    PHYSODRAFT_321565
Exosome [BR:psoj04147]
 Exosomal proteins
  Proteins found in most exosomes
   PHYSODRAFT_321565
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl
Motif
Other DBs
NCBI-GeneID: 20644680
NCBI-ProteinID: XP_009515116
JGI: Physo3_321565
UniProt: G4YK79
Position
Unknown
AA seq 697 aa AA seqDB search
MSGVSVGSRKGASPHDLAAGSDNEGTPPSDEASEPTGCTIGIDFGRTKCEAAVVAEDGSA
ALIPLELLAPEKCFSLPSYVSMGATGEWEVGLQAVSRAKAGHPYTVYDLTMLLGKKLDAL
RQRDVERWAFILRSGVADKAVVECPTKSNTPDLAYPEQLVSKLLSTIKQRAEVFTGKRVT
GAVLSVPAAYNRTQRQALRDACSIAGIPVEKLVISSSASAVAHADSLTDANSSEKMALVV
DCGGGSLDVTLARVRANAAEDSSTGIEIQVEATAGDLETGGEALTDQLFDHFYQEAKASD
TSTKTSSPAFSRRLRRACVLAQRILSTSQQAAIDLPPWLLRRGARGSGSATGAVAGFSSS
ISRADFETLCGTERWSRLPDTVDQVLARAKVPKFREVLGDCFAEHWSRIVDLPKHTVAVG
AALIAAQNGRHSLLYEPTPLALGIRSASGDTLVVVPPSTPLPTRQSRVYYASCQSEITFD
ILEGLEQQANHSPGNTSSLEHCMGSVPIDKTRASAPLILRLEIVFEVDVTDRLAVVVSDN
SNNRTTRLVVAGDETCLSPEAIALAKAHLSETLKNSGDVENESKPAPPSLALTISPQSLA
PVEACPIDSLRSCVAALAPMVQTNRPSVCIPPGDVFILRSRVEHASAWLAQVDSNALNTD
QQRHMAREYLRQIRVLHLSSTASSAFSQLRQELDLLN
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggcgtcagcgttggtagccgcaaaggcgcaagtccccatgatttggctgcagga
agtgacaatgagggcacgcctccatccgacgaagcttctgagcccactggctgcaccatc
ggcattgacttcggccgtacaaagtgcgaagctgctgttgtcgctgaggacgggagtgca
gcgttgattccattggagttgctagccccagaaaagtgtttctcgctgcccagctacgtg
tccatgggggccactggtgagtgggaagtcgggttgcaagcggtgagtcgtgctaaggct
ggacacccgtacaccgtgtacgacttgaccatgctacttggcaaaaagttggacgcgcta
cgacagcgagacgttgagcgctgggcgttcattctccgttccggtgttgctgacaaagct
gtggtagaatgccccaccaagagcaatacccctgatctggcgtaccctgagcaactcgtt
tccaagcttctgtccacgatcaagcaacgtgccgaggtcttcactggaaagcgcgtcact
ggtgccgtattgagcgttccagcagcgtacaaccgcacgcagcgtcaggctcttcgggat
gcgtgcagtattgctgggatccctgtcgagaaactcgtgatatcgtcatcggcatctgct
gttgcccacgcagactcactcacagacgcaaacagtagcgagaagatggcgctggtagtg
gactgcggcggtgggagtttagacgttactttggctcgagttcgtgcaaatgcggccgag
gactcatctacggggatcgaaattcaagttgaagcgacagcgggtgatctcgaaacggga
ggcgaagctctcaccgatcagctcttcgaccatttctaccaagaagccaaggcgtccgac
acgtccacgaagacatcaagcccagcattctcccgccgtcttcgacgtgcctgtgtcttg
gcgcagcgaatcctctccacatcgcaacaagcagcaattgatctcccgccttggctgctt
cgacgtggagctcgcgggtcaggatcagccactggagcggtcgcggggtttagtagcagc
atctcgcgagcagattttgagaccttgtgtggaacagagcgatggagtcgtctaccagat
accgtcgaccaagttctggcgagagcgaaggtgccgaaattccgtgaagtgcttggagac
tgcttcgcggagcactggagccgtatcgtggacctacccaaacacactgtcgcagtcgga
gcggccttgatcgcagctcagaacggtcgacactcgttgctctacgagcccacaccgttg
gcactaggtatccgcagtgccagtggagacacactggttgtggtaccgcccagtaccccg
ctgccaacgcgacaatcgcgagtctactacgccagttgccagagcgagatcacgttcgac
atcctggaaggcttggagcaacaagcgaaccatagtcccggaaacaccagcagcttagag
cattgcatgggttccgtgcctatcgacaagactcgtgcatctgctccgttgatattgagg
cttgagatcgtgttcgaggtggacgtgaccgaccgcttggcggttgtggtctcggacaac
tcaaataatcgcacgacgcggttggtcgtagctggggatgaaacgtgtctctcacctgag
gccattgcactggcaaaagctcatctgagtgaaactctgaagaactctggcgacgtggaa
aacgaatccaaacccgcacctccgtcgttggcgttgacaatttctccacaaagtctcgca
cctgttgaagcttgtccaattgactccctgcgctcctgcgtagctgcgttggcacctatg
gtgcagaccaaccgccccagcgtctgcattccacctggagacgtgttcatcctgcgttca
agagttgaacacgcgagcgcgtggctagctcaagtcgattcgaacgcgctcaataccgac
cagcaacgacacatggcgcgcgaatatctccgtcaaatccgcgtgctccacctctcgagc
actgccagcagcgccttctctcaactgcgtcaggaactggacctgctcaactaa

DBGET integrated database retrieval system