KEGG   Phytophthora sojae: PHYSODRAFT_321646Help
Entry
PHYSODRAFT_321646 CDS       T03459                                 

Definition
(RefSeq) family 3 putative glycosyl hydrolase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
psoj  Phytophthora sojae
Pathway
psoj00460  Cyanoamino acid metabolism
psoj00500  Starch and sucrose metabolism
psoj01100  Metabolic pathways
psoj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psoj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PHYSODRAFT_321646
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    PHYSODRAFT_321646
Enzymes [BR:psoj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     PHYSODRAFT_321646
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C Fn3-like
Motif
Other DBs
NCBI-GeneID: 20644694
NCBI-ProteinID: XP_009515207
JGI: Physo3_321646
UniProt: G4YPF2
Position
Unknown
AA seq 696 aa AA seqDB search
MAATAADDSVLDARAQTIVDGFTTAQDNTLNEDWVRLYAQQYVGSYLNTIWDEPMEEKYG
WTASEFRAVIKPIQEISMEENGGHPIIYGLDSVHGANYVDGAVISPQQINSGASFNPDLV
YETGRITARDTQAAGVPWVFGPILEISQNPLWSRTYETFGEDPYLAAVMGDAIVRGLQSY
NQTAACMKHFIGYSKTPTGHDRDNVIMADFDLLNYFLPPFKAAIEAGAIPRILNDLLRSD
LGFDGLLVSDWAEINNLKDWHRVVNSYEDAVALSLKETSLDMSMVPNDTKFIEYAQNMLE
KYPENEARLRQSAKRIIKTKLKLGLYETPVPGEQFVSMVGSDDDKTAALNMARESIVLLK
NAEDVLPLPKDASVFLTGHSANNVGYQCGGWSKAWQGYSGNSMFPNGVSVRQGFENLVGN
SSFTYFNGLLANGSISDEDSATAVSLASQHEYTVAVIGESQYTEKPGDIDDLALPEGQVK
YIEALRATNTKTIVVLFEGRPRLLGSIPDHSMAIIDGLLPCELGGQAMAEIIYGEVNLSG
RLPITYPKDPANIAIPYNHRVTTRCTWDNCWQQWDFGSGLSYTQFSYSAVTLDTTLLTSA
AETETLMLFLIQPYRLISVPEVKQLKKFKKIELQAGESMDIGKGLKRVFEDSDYVVAIKP
ETWCNVYNNITHPLCAELSVDTSSGAGTVNVGSGLP
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atggcggcaactgctgcagacgacagcgtgttggacgctcgagctcagaccattgttgat
ggattcacgacggcgcaggacaataccctcaacgaggactgggtgcgtctgtatgcccag
cagtatgttggctcctacctcaacactatctgggacgaacccatggaggagaagtatggc
tggaccgcgtccgagtttcgcgctgttatcaagcccatccaggagatctcaatggaggag
aacggaggccacccgatcatctacggcctcgactcggttcacggcgccaactacgtcgac
ggagctgtcatttccccccagcagatcaacagcggagcaagtttcaaccccgacctcgtc
tacgaaacgggacggatcacggcgcgtgacacccaagcggctggagtcccgtgggtcttt
ggccccattctggagatctcccagaaccccctctggtctcgcacgtacgagaccttcggc
gaggacccatacctggcggccgtgatgggagacgccattgtccgcggtctccagagctac
aaccaaacggctgcctgcatgaagcatttcatcggatactccaaaaccccaaccggtcac
gaccgcgacaacgtcatcatggcggacttcgacctgctgaattacttcctgccgccgttc
aaggctgccattgaggctggcgccatccctcgcattctgaatgacctgctccgctcggac
cttggcttcgatggtctcctggtttcggactgggctgagatcaacaacctcaaggactgg
caccgcgtcgtaaacagctacgaggatgcagtggccttgtcgttgaaggagacatctctt
gacatgagcatggtgcccaacgacaccaagttcattgagtacgcgcaaaacatgctcgag
aagtaccccgagaatgaagctcgtctgcgtcagtcggcaaagcgcatcatcaagacgaag
ctgaaactgggactatacgagaccccggtgcctggcgagcagtttgtctccatggttggc
agcgacgacgacaagactgcggctctgaacatggctcgcgagtctattgtgcttttgaag
aacgccgaggacgtcttgcctctgccgaaggacgcctccgtcttccttacgggccactcg
gcgaacaacgttggttaccagtgcggtggatggagtaaggcttggcaaggatactctggc
aactccatgttcccgaacggcgtaagtgttcgacagggctttgagaacttggtcggcaac
agctcgttcacgtacttcaacggactactagcgaacggctccatttcggatgaggactcg
gctacagctgtgagcctcgcaagccagcacgagtacacggttgcagtcatcggcgagtcc
cagtacacggagaagcctggagacattgatgatctggcgctgcctgagggacaggtgaag
tacatcgaggcgctgcgggcgaccaacacaaagacgatcgttgttctgtttgagggccgt
ccgcgcctgcttggatcgatccccgaccactcaatggccattatcgacggtctcctgccg
tgcgagctcggcggtcaggcgatggctgagatcatttatggcgaggtgaacctgagcgga
aggctgccgatcacgtacccgaaggacccggctaatatcgccattccctacaaccaccgc
gtcacgacgcgctgtacttgggacaactgctggcagcaatgggactttggctcgggtctc
agctacacgcagtttagctactcagccgtaactctagacacgacgctgctcaccagcgcg
gctgaaacggagaccctcatgctgttcctgatccagccgtaccgcctaatctcggtgccg
gaggtgaagcagctgaagaagttcaagaagatcgagcttcaggccggagagtccatggac
atcggcaaggggttgaagcgagtgttcgaggacagcgactacgtagtggccatcaagccc
gagacgtggtgcaacgtgtacaacaacatcacccaccccttgtgcgccgagctcagcgtc
gacacaagcagcggtgcgggcacggtcaacgtcggcagtggactcccttaa

DBGET integrated database retrieval system